Conserved Protein Domain Family
UPF0182

?
pfam03699: UPF0182 
Uncharacterized protein family (UPF0182)
This family contains uncharacterized integral membrane proteins.
Statistics
?
PSSM-Id: 397657
Aligned: 225 rows
Threshold Bit Score: 707.312
Threshold Setting Gi: 524756220
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015185479           18 FRFVTVLLGVWLA-WDLLSHLVAEVLWFSELG--YLSVLLKRLAYQIGVGVLVCVTSAG-FLLGNLFL---------ANQ 84   Micro...
jgi:Mahau_1949          7 IGWLVTIIIAVIIvLLALTGFFVDYQWFDSIG--YLSVFMTRFITQAQIAIPVFIAVFA-VLYAYSSM---------VKR 74   Mahel...
CDB01951                8 LSFIILAIVLVVVlFVSLIGFIADFLWFKEMG--YLSVFFKKLVTQLTVGVPTFIVVTG-LVYLYLSK---------LKK 75   Firmi...
goetting:EAL2_c00250   10 VAVAVVLAVVIVLsFSNVIGFLADYNWFKEVG--YTSVYLRQVFAKLIVGTPIFAVLMA-FIFLYLIG---------IKK 77   Pepto...
WP_014263185           15 LWILIGIFFVLFLiSTQLITFATDIVWFRQIG--YLSTYLRGVFASLMIGVPTFFGVSL-LVYLFFNK---------TYK 82   Filif...
CBH20178               17 ITIIFMVIIAVISsFGKLLDFWTDFLWFKEVG--YTSTYIKQVFAKLYIGIPFFVAFTV-FMYIYLQR---------IKS 84   [Clos...
WP_025436451           12 PGLLITVLIILAIgLRAIVNFITDFQWFGKNE--FLSTFLTRVVTELGILIPLWILAGL-GLHAYIKK---------LKQ 79   Pepto...
A6TJ97                 16 IGLGIFIFIFLFGfLSEILSFITDYQWFQELG--YESVFLTKLKTQLQIGIPLFIVGTI-LYYLYLIG---------LKK 83   Alkal...
WP_014355330            8 LLIGLAAIIVIFTiLLSLNQFYLDYLWFAEMG--YTEIFLKELVTKTQIGIPIYIGLVL-ILFFYLKL---------LNY 75   Aceto...
CCY99778               36 rkiVLAITAIVLAiCYI--YARGNYLEMKEIGekYIEVFKKDFIYTIITFVVNFIILFFsFYFTNKTIrkglkvffdDEK 113  Clost...
WP_015185479           85 Fkysdtslisrlapeevrvssqrlarinlrldplpqtaprsiregtgtafrvdapksslplnlrsllvvvfflsllvgmm 164  Micro...
jgi:Mahau_1949         75 D------------------------------------------------------------------------------- 75   Mahel...
CDB01951               76 G------------------------------------------------------------------------------- 76   Firmi...
goetting:EAL2_c00250   78 S------------------------------------------------------------------------------- 78   Pepto...
WP_014263185           83 D------------------------------------------------------------------------------- 83   Filif...
CBH20178               85 N------------------------------------------------------------------------------- 85   [Clos...
WP_025436451           80 K------------------------------------------------------------------------------- 80   Pepto...
A6TJ97                 84 E------------------------------------------------------------------------------- 84   Alkal...
WP_014355330           76 I------------------------------------------------------------------------------- 76   Aceto...
CCY99778              114 K------------------------------------------------------------------------------- 114  Clost...
WP_015185479          165 llhygkiglslwhrdmsllnvtpplptafdwtsvqtlvqqawnneiwqigvlvVV-------VVALIVNPQFWLIAIASA 237  Micro...
jgi:Mahau_1949         76 -----------------------------------------------------YMrymaaalTKRQSRLLNTVIITALLF 102  Mahel...
CDB01951               77 ------------------------------------------------------YfskiassEETDMRKLRKTTIALSAV 102  Firmi...
goetting:EAL2_c00250   79 -----------------------------------------------------YYshmnivpENSHEKKINGIILLFSGA 105  Pepto...
WP_014263185           84 -----------------------------------------------------FLvhfntleEENQRKPVKRGIALVTFV 110  Filif...
CBH20178               86 -----------------------------------------------------YYkymniltTKDEEKTLNQTMGVVSVL 112  [Clos...
WP_025436451           81 -----------------------------------------------------YYvqahieyDKQADRGIELGAAIFSGV 107  Pepto...
A6TJ97                 85 -----------------------------------------------------YYkqiksyhMDISEKRVNQILILPAFV 111  Alkal...
WP_014355330           77 ------------------------------------------------------SskylgetQK-KTKKQNFIAIGVSAV 101  Aceto...
CCY99778              115 -------------------------------------------------------------------EMPKFPNKSVSFV 127  Clost...
WP_015185479          238 FSLFFALVLSAQ-WSRILLYFYPTLFEANDPLFGRDISFYIFNFPVWQLFDFWLGGLFIFGLAAVLLIYLlag------- 309  Micro...
jgi:Mahau_1949        103 ISAVIALSESSGiWSQWLTFINSSDFGIKDPIFGRDLSLYMFRLPFLHSLYSFILNFTVILAILTILVYAlmymsdktrf 182  Mahel...
CDB01951              103 FGIFATVMTIMQlWFEILKFANGTSFDISDPLFNMDISFYIFKLDFLTQLNEILIGVIIGFIILTVIYYIilmtvrtpdv 182  Firmi...
goetting:EAL2_c00250  106 MGFAYSFSLASKfWIEMLRFTNSTSFNIKDPIFSKDVGFYVFKLPLINEIFNSLIGFLVFLLFITVIFYFilvsdeaskg 185  Pepto...
WP_014263185          111 LSFGFTRAVVSEgWMNMLKAIHGVSFGINDPIFQKDLGFYVFQLSFMNEILLALSSLVVLLFLTTIVFGFllilylsptl 190  Filif...
CBH20178              113 TALFFSFGIAGSfWMQILKFINATSFNIKDPIFIKDIGFYVFTLPLVTEIFTFLLGFIIFLMLITIVIYIvlisirqpmd 192  [Clos...
WP_025436451          108 FSGVMAWVIADSiWLKLRMFLNATRFDGADPIFGKNIDFYMFKLPLYQQLLSIGIFVTILVIGITVGFLFvmltlrapse 187  Pepto...
A6TJ97                112 FGLMTSTSVAGSlWFDILLYANAKPFNLTDPLFNNDITYYLLELPFLKQLLNTVTSILFLMVIITVIFYVimflirrptl 191  Alkal...
WP_014355330          102 VALFLTFYIADRlWYQILEFVNRTQFNLTDPIFNQDLALYFFELPLYEEIFSIFIGFFVTIVILTFLYTAyilyqgkkvr 181  Aceto...
CCY99778              128 IALIGSLLSTKMlLNKILLCFSGSRFGIADPVFHIDISFFVFIKPLIQFILIYLLVIVIATLVYAVVYSLivlnksfd-- 205  Clost...
WP_015185479          310 -----------------------------------------------------------esfSDGKFPGFSQSQLRHLYA 330  Micro...
jgi:Mahau_1949        183 yrlf----------------------------------------------------ekdnvvrvvsnkdiVRAAIKRIAW 210  Mahel...
CDB01951              183 fkeevppdaqpadgeerysgssnpfengnkktnnandffgkfseaftgkkyqarpvkpkkqfDDTNFKQLMHIASGKISL 262  Firmi...
goetting:EAL2_c00250  186 qrtf---------------------------------------------ekdidldvrrfrnIASTPMQLFTLAMNQIVT 220  Pepto...
WP_014263185          191 ldrheee----------------------------------------------regirfihpekrlqnqvSTFFVKRLRF 224  Filif...
CBH20178              193 keelgsk----------------------------------------------irrlrtensfvslqkrvMELALDQIML 226  [Clos...
WP_025436451          188 gsiy--------------------------------------------yineskrrnnlisiATARKKELFNSALRKIAF 223  Pepto...
A6TJ97                192 -----------------------------------------------------yevkadlqwNSNFFVSLLQIALKQFAA 218  Alkal...
WP_014355330          182 fd-------------------------------------------------reqdletikdnAKGIFKAYLEIASKQIGI 212  Aceto...
CCY99778              206 --------------------------------------------------------------gvsresiaKCDLVSKVGM 223  Clost...
WP_015185479          331 LGAGTVA-IVAVRYWLSRYELLYFTRG-V---------TYGASYTDVTAQLPVNTALSLLTVAIALWLFVQTiFWFRhfq 399  Micro...
jgi:Mahau_1949        211 LGFIFFL-TLAFGYYLKAFDLLYSTRG-K---------VVGAGYTDIHVTLLFYRILMIVSVAGAFVFIIGA-IRQK--- 275  Mahel...
CDB01951              263 LGFIFFI-MLGLSFFLQQFDLLHTHTG-A---------VYGAGFTDVTVTLWKLRILCVLSVIAAIMFVLNM-KKKA--- 327  Firmi...
goetting:EAL2_c00250  221 IAVVFFM-IVALRNYLDTFNLLYSSRG-A---------AYGASYTDIKITLWVYRVQMILALVSAGVIVYAY-MKKK--- 285  Pepto...
WP_014263185          225 FGAMFFL-LIAGRSLMLSYFLLYSQRG-A---------VFGAGYTDVAINLWVYRIDAVLASVAGVVLLVRKkLSKK--- 290  Filif...
CBH20178              227 IGVVFFV-IIALRSYLASFALLYSETG-A---------IYGAGFTDINVTLGVYRIQMVVSIASAIALILAR-YKRN--- 291  [Clos...
WP_025436451          224 LGMAVFL-MVSAKYFLQIYELMYSTSG-V---------AYGASYTDIHVTLIAYRVVAVISLVSAFTVAYGL-LKGQ--- 288  Pepto...
A6TJ97                219 LGVIFFL-VLAARYYLGVYDLLYSTRG-V---------VYGASYTDTHVTLWVYRAQILASLLSATGVVYAY-VKRN--- 283  Alkal...
WP_014355330          213 FLGVFFI-ILSLGSFLDAFKLLYSNAG-I---------VYGAGAADIDVGLKVIIFKGILCLVLAATSVVAG-YKKK--- 277  Aceto...
CCY99778              224 RVKLIGIlIGLIVIAFMVLNIGNEKFMnIeltdgtqysIYGAGNGDTTVKLAGYVLLAIL-CVISIFKAYKAlKEKS--- 299  Clost...
WP_015185479          400 tsgrreL----IALGVYLGVSVvAGVALPAAVQRFRVEPNEIAVERPYIARSIALTRAAFDL--EDIEVETFNPQGTLTN 473  Micro...
jgi:Mahau_1949        276 ------IwwaaSAPLAIVALLV-VSAVAGGVVQGLIVSANEFKKEQPYIENNIKYTKMAYGL--DKIEEKDFNADQTLTV 346  Mahel...
CDB01951              328 ------YkkilTVPVIMIAVGL-LGTGAGMLIQNFIVSPDELNKEKEYLERNIEFTQYAYQL--EDVTTTSFAADNTLTG 398  Firmi...
goetting:EAL2_c00250  286 ------LklalVAPVIMIAVAL-VSAGVENLVQNFIVSPNELAKEREYIKHSIKYTQLAYSL--DKIVEKDFAAEQNLDA 356  Pepto...
WP_014263185          291 ------FvlslIGITLVINLGS---TFLETTVQNFVVAPNELSKEKPYIENAIKYTKLAYGL--DKIETREFDLKNDMTA 359  Filif...
CBH20178              292 ------KklaaIGPIALVAVYL-LGLGAEIAVQAVIVSPNELARERKYITNSLEYTKMAYGL--DDIDVENFSVDQDLTY 362  [Clos...
WP_025436451          289 ------FklaaSGPVLMIGVSI-IFGIVGYVVQQLIVEPDEIEKEKEYLVYNIEHTQKAFAL--DDVKVSEFPVEQSIVR 359  Pepto...
A6TJ97                284 ------PklllIAPISIIAVGI-LGNVISLGVQNFIVSPNEIARELPYIEHNLSYTRRAYGI--GEIQETDFPYDTELTR 354  Alkal...
WP_014355330          278 ------YlhmgAGPVIFVVVII-VGGLAQGMYESLAVVPNQFTKEEPYIANNIEYTQQAYDL--ANVETREFTATQEIGA 348  Aceto...
CCY99778              300 ------TrrvlGNLMIVPIYLI-ILAVVLAGYQLIFVGSNALDKNQNFIKENIEKTKQAYGIttENVTEKNIQYSGTLTS 372  Clost...
WP_015185479          474 NILENNELTIRNIRLWDTRPILQTNRQLQQIRPYYRFPNADIDRYTLKVAatgdspiaprtedegqeiektniaptkplv 553  Micro...
jgi:Mahau_1949        347 QDLNENRDTIDNIRINDYRPALEVYNQLQGIRLYYQFNDIDIDRYMLDERy----------------------------- 397  Mahel...
CDB01951              399 SDIAENSETISNIRINDFDPAQQFYNQTQSIRQYYTFNDVDNDRYMIDGKy----------------------------- 449  Firmi...
goetting:EAL2_c00250  357 QKITDNNQTIKNISVNDQGPVKDVFKQIQGIRTYYKFNDIDVDRYTIGNEt----------------------------- 407  Pepto...
WP_014263185          360 EGLSQNQETVMNISLNDYRPTNEAFNQLQGLRGYYRFSDVDIDRYVLDGNl----------------------------- 410  Filif...
CBH20178              363 DDLLENQDTISNISLNDYRPTKEAYNQLQGLRNYYKFHDVDIDRYIIDGKl----------------------------- 413  [Clos...
WP_025436451          360 QDLANNSATIGNIRINDARPLKETYNQIQGIRLYYSFNDIDLDRYKINGEy----------------------------- 410  Pepto...
A6TJ97                355 EDIENNQEIIDNIRINDYRPALEVYNQIQAFRPYYRFVDVDIDRYWVNGEy----------------------------- 405  Alkal...
WP_014355330          349 TDIEANNATIDNIPINDQIPTQEMYNSLQGIRNYYQFNDVDVDRYFVNGVy----------------------------- 399  Aceto...
CCY99778              373 AEISKNQDLLTNIAIVNKQNVLQDLNAAQTAKGYYSFRQAQIASYNIDGKp----------------------------- 423  Clost...
WP_015185479          554 terQQVVISARELDYQGVPQQAKTWVNQHLIYTHGYGFTLSPVNTVAEGGLPAYFVKDIGtgadggvegalttsSpliRD 633  Micro...
jgi:Mahau_1949        398 ---TEVFLSPRELNIDKLPDNAKTWINQHLRYTHGYGVVMSPVNAVTPSGQPQLIIKDIP--------------Pk-nAD 459  Mahel...
CDB01951              450 ---TQTYLATREIDESKISD---SWLNRHLKYTHGYGITLSRVDKVAASGQPDVLIGNIP--------------PessVE 509  Firmi...
goetting:EAL2_c00250  408 ---RQVFIAARELDSESLQSK--TWLNEHIKYTHGYGIVMAPVNEVTPSGQPNLFLKNIP--------------PvssVG 468  Pepto...
WP_014263185          411 ---TQVFLSVREMDKSKLEDKAQNWINTKLKYTHGYGLAMAPVNQLTPSGQPEMVMKNVP--------------VqsnYP 473  Filif...
CBH20178              414 ---TQMFLSVRELDKEALDDNAKTWVNQHLKYTHGYGLTMSPVNKVTSSGQPSMVVRNVP--------------PvsdYK 476  [Clos...
WP_025436451          411 ---KQVFISPREMDQNKLPDQAKTWINMHLKYTHGYGIVMSPVNAVTEEGQPQLIFKNVP--------------Pv-tST 472  Pepto...
A6TJ97                406 ---RQVFIAPRELDQRELSDNAQTWINQTLKYTHGYGVALSPVNEVTSGGQPVLWMRNFP--------------Lv-sSV 467  Alkal...
WP_014355330          400 ---TQVFLGAREMNNELLPDEAKTWVNQHLKYTHGFGVAVSPVNKTNNVGQPDLIVKDIP--------------PttdVA 462  Aceto...
CCY99778              424 ---TLVYVTPREISDKDA-----TYSNKTYQYTHGYGSIITLAGSTDEYGNLKNIQKDFGdt---------------sNE 480  Clost...
WP_015185479          634 SIPIGAPRIYYGEITNTYVMTST--RVREFDYP--SGD-ENAYNSYDGTGGIAIgSLWRRVLFAQYLKDWQMLLTRDFTP 708  Micro...
jgi:Mahau_1949        460 GVDIKRPEIYFGESTDQYVIVKT--GQKEFDYP--MGE-QNKETIYQEETGIAM-SFANRLLFTLYTGDFRLLLSSDINA 533  Mahel...
CDB01951              510 EIQITRPEIYFGELSNEYVIVGT--DEDEFDYP--SGE-SNEYTRYEGDAGINM-NFFNRLVFAVKEGSVKLLVSSNIDS 583  Firmi...
goetting:EAL2_c00250  469 GIEVKRPEIYFGEVASGYIVVGT--SEKEFDYP--KGD-TNAFTEYEGKAGINL-GFFRRLLYSIDQKSFKLLVSAGIDS 542  Pepto...
WP_014263185          474 NLKLEKPQIYFGELAADYVIVNT--KELEFDYP--KGE-SNEMTQYQGNGGIPL-NFVNRLLFAMRQRDFKILISENITS 547  Filif...
CBH20178              477 ELEVTVPQIYFGELTNDYVVVNT--DEQEFDYP--MGE-ELQTTKYQGTAGIKL-NFLNKALYSIREGSFKLLVSGGVNS 550  [Clos...
WP_025436451          473 ALVIKRPELYFGELTNDYIIVNT--DESEFDYP--SGS-DNVTTRYEGKAGIEL-GGINKLLYAYRERSMKLLVSTVVNS 546  Pepto...
A6TJ97                468 DIEVTRPEIYFGELTDQYIIVNT--KEKEFDYP--LDN-DNAETLYEGTAGVPL-KGVNRLLYSWRQGTLKMLLSGNITS 541  Alkal...
WP_014355330          463 ELTIDEPRIYFGENDYNYVVTNC--TTAEFDYP--QGD-NNQEVTYTGTAGIKM-SLLNKLAFALNFGSSELFLANEITD 536  Aceto...
CCY99778              481 TIPIKQPRIYFGMDTNNAIVINSkkS--ELDYPtsDSNnE-NEYNYTGNAGLKL-NLLDRIILGIKEGDMNLAFSGSVTG 556  Clost...
WP_015185479          709 QTQLLFRRNINQRIRAIAPFLQYDREPYLVAADagqgnnvqnqNYLYWIVDAYTTSDRYPYSDP---G--KYgfNYIRNS 783  Micro...
jgi:Mahau_1949        534 GSRILINRDIADRVRMIAPFLRYDDDPYIVIDDd---------GRLYWIIDAYTTSNRYPYSEPds---mnLgvNYMRNS 601  Mahel...
CDB01951              584 DSKIIIHRNVMDRVRTIMPYLSYEDDPYMVTVD----------GKLYWMVDAYTESSNYPYSQPfdde---rgtNYIRNS 650  Firmi...
goetting:EAL2_c00250  543 NSKIILHRNIADRVNKIAPFMQFDQDPYMVLSDe---------GRLYWIMDGYTLSDRYPYSEPfdk----srlNYIRNS 609  Pepto...
WP_014263185          548 DSKILIYRDVLGRVKKIAPFLSYDSDIYPVAVN----------GRVMYLIDGYTVSENFPYSQPivnrngtEkmNYIRNS 617  Filif...
CBH20178              551 DSKIIINRNIMDRVNKIAPFLSYDEDPYAVVVN----------GKIYYIIDGYTTTKYFPYAEPf-----nEnaNYIRNS 615  [Clos...
WP_025436451          547 DSRIIFYRNIMERVNRIAPFLEYDQNPYLVLNQa--------dGKLYWIIDAYTTSQYYPYSQPfelN--QKqiNYIRNS 616  Pepto...
A6TJ97                542 ESRIVFDRNIVTRMNKIAPFITYDEDPYIVINE----------GKLYWMIDGYTISGNFPYAEPyma----gnnNYIRNS 607  Alkal...
WP_014355330          537 QSRMLIHRNIAERVSMIAPFLSYDSDPYMVISE----------GHLYWIMDAFTTSSRYPYSQPygg----stnNYIRNS 602  Aceto...
CCY99778              557 ESSIITNRNIIDRAKTIMPYLMYDENPYMVIDDd---------GNQIWVLDAYTVTNEYPFAQKtel-setKeiNYIRNS 626  Clost...
WP_015185479          784 VKIVIDAYNGSTDFYVADPQDPIIRSWSAVFPGLLKPLSTMPVTLHSHIRYPLDFFSAQSERLLTYHMTDPQVFYNREDL 863  Micro...
jgi:Mahau_1949        602 VKVIIDAYNGKTDFYLVDKTDPVANVYKGIFPKLFKDADDMPDGLKDNLRYPQLLFDVQAEIYRRYHMTDPQVFYSGEDA 681  Mahel...
CDB01951              651 VKVVVDAYNGDVDFYIVDEEDPIAATYAKIYPTLFKSGDQMPEGLKAHIRYPNSLLQIQADIYTRYHMEDISVFYLNEDQ 730  Firmi...
goetting:EAL2_c00250  610 CKVVVDAYNGDVDFYIVDESDPIVNTYSKIFKGLFKSFDDMPADLRAHVRYPKTYFNIQATMYQDYHMNDAEVFYNKEDR 689  Pepto...
WP_014263185          618 FKVVVDSYDGDVSFYLLDETDPIVKTYAKIFPDLFKPIDTMPEGVKEHLRYPQQLFDIQSEIYSTYHMNDSQVFYNREDQ 697  Filif...
CBH20178              616 FKVIIDAYNGDVNYYIVDEKDPLVETYSKIFPKLFKPMSDMPKEFISHLRYPQTMFDIQAKMYGTYHTNQPDIFYNREDK 695  [Clos...
WP_025436451          617 VKVVIDAYEGTTKFYIFDENDPVVQTYSKIFTDLFTSKSKLTPGLLEHIRYPQDYFDIQSEVYRSYHVDNPVVFYNGEDI 696  Pepto...
A6TJ97                608 VKVVIDAYNGTVDYYISDEEDPIILTYQAIFPDLFKPLDDMPEGLKAHIRYPQVLFDIQSEVYATYHMNNPRVFYNKEDL 687  Alkal...
WP_014355330          603 VKVVVDAYNGDVSFYKVD-DEPVLATYSKIFPGFLKDLSEMPEGIRAHLRYSKTMFDVQSDIYKTYHMSNARVFYNKEDQ 681  Aceto...
CCY99778              627 VKVLINAYDGTMNFYITDRTDPIAMAYNKIYPDIFKNSDEISEGISKHFIYSQYLYDIQSKIIDKYHNIQPETLYRANDV 706  Clost...
WP_015185479          864 WRIPQEIYA--AKSQP--VEPYYLIMRLPTATSEEFILLNLYTPVTRNNLIGWLAARSDGDQYGNLLLYQFPKQELVYGP 939  Micro...
jgi:Mahau_1949        682 WNIANEKYG--NEIQE--IESQYIIMKLPEEDKAEFILMVPFTPVKKDNMTAWMAARMDGDDYGKLIVYRFPKDKLVYGP 757  Mahel...
CDB01951              731 WDIAYEIYG--TEQVQ--MTPTYYIAKLPGEERAEFFNSIPFTPKSKKNMTALMVARNDGDHYGELVLYQFPKSKTIYGP 806  Firmi...
goetting:EAL2_c00250  690 WQIARETFE--NQEEPviMEPSYTTFKLPGDEKAEFLLSIPYTPKQKQNMVSLLVVKNDGDSYGEIIDYSFPKNKNILGP 767  Pepto...
WP_014263185          698 WSIPSEFYG--GEESK--MESIYSTYRIPGEKQAEFLLSIPYTPKAKQNLTGLLIARNDGEEYGKLILYRMPKDKIIIGP 773  Filif...
CBH20178              696 WEIAKQNYQ--DKIQE--MESLYFTFELPGEGKPEFVLSIPYTPTGKQNMTAFLVARNDGDNYGKLKLYEFPKSKTIIGP 771  [Clos...
WP_025436451          697 WDKANEKYM--ESVQR--IESNYVMFKLADSEIQEFALMLPYTPREKPNMTSLLVARSDGENYGKLYMYKFPKDKTIQGP 772  Pepto...
A6TJ97                688 WRIAREKYD--QNEQT--IESQYMMMKLPGEESEEFVISVPYTPIRLDNMRALLVARNDGEQYGELIAYRMPKDQNVYGP 763  Alkal...
WP_014355330          682 WQTSTQFYEaeKKEVP--VESAYTIMELP-DRDAEFMLTVPFTPKDKDNMIAWLAGVSDGEDYGTLILYEFPKQQLVYGP 758  Aceto...
CCY99778              707 WDVAETfdsd----ktekMKSYYTMVKNE-NGDLEIGLVIPYTLYGKQNITSYMIGT-SVNGTNKLTLCNFEADSNVLSP 780  Clost...
WP_015185479          940 EQIEALINQDPVISQQISLW 959  Microcoleus sp. PCC 7113
jgi:Mahau_1949        758 MQVEYSIDQDTNISKELTLW 777  Mahella australiensis 50-1 BON
CDB01951              807 EQVEAQIDQNTEISKEFSLW 826  Firmicutes bacterium CAG:145
goetting:EAL2_c00250  768 YQVESKIENQPEISEKLTQW 787  Peptoclostridium acidaminophilum DSM 3953
WP_014263185          774 QQMEGKFSNNDKISKDLSLW 793  Filifactor alocis
CBH20178              772 EQVEARISNNDVISRDLSLW 791  [Clostridium] sticklandii
WP_025436451          773 LMIESRIDQDSVISPQFTLW 792  Peptoclostridium acidaminophilum
A6TJ97                764 KQIEDRIDQNTTISQNLSLW 783  Alkaliphilus metalliredigens QYMF
WP_014355330          759 MQIEQRIDQDTVISPQLTLL 778  Acetobacterium woodii
CCY99778              781 IQLETQINQDETIASDIAsl 800  Clostridium sp. CAG:793
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap