2Y7T,1A6C


Conserved Protein Domain Family
Nepo_coat_N

?
pfam03689: Nepo_coat_N 
Nepovirus coat protein, N-terminal domain
The members of this family are derived from nepoviruses. Together with comoviruses and picornaviruses, nepoviruses are classified in the picornavirus superfamily of plus strand single-stranded RNA viruses. This family aligns several nepovirus coat protein sequences. In several cases, this is found at the C-terminus of the RNA2-encoded viral polyprotein. The coat protein consists of three trapezoid-shaped beta-barrel domains, and forms a pseudo T = 3 icosahedral capsid structure.
Statistics
?
PSSM-Id: 397651
Aligned: 23 rows
Threshold Bit Score: 89.623
Threshold Setting Gi: 75569132
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2Y7T_A      2 LAGRGVIYIPKDCQANRYLGTLNIRDMISDFKGVQYEKWITAGLVMPTFKIVIRLPANAFTGLTWVMSFDAYNRI-T-SR 79  
Q86631     85 WSAVTPFKCAAEAAENTILARWSLRSIISESGTDAWTKWQRELPTTFLVTGTIAMSVNIMAGTTLGLVCDVFNRSkL-LD 163  Cherry leaf roll ...
ABM65096  270 LMSATSYNVSKDVAAGVVIGRLNLVERARVDNTIPYLEWLSKGMVHPKLEVEILAPTNMFMGTTIGVVLDVANRLgT-LN 348  Tomato white ring...
ABL84275  156 LAFAKMYQCKKDAKAGHVLATVDIQTRVFEDNRRVALDWLAHGLASFKYDLQLTVGSNPFVGVTLGITIDAFDRLlP-QI 234  Blackcurrant reve...
ABN45882   10 AAFLGKVTCAKDAKGGTLLHTLDIIKECKSQNLLRYKEWQRQGFLHGKLRLRCFIPTNIFCGHSMMCSLDAFGRYdS-NV 88   Tomato ringspot v...
Q9IV56    636 LVGVKWVSVPKDAKQSAFLGTHNFREIAKEYAGEFYNRWVYNRNISPCILVRCHLPKMPFLGLTLGMCADFYNRIkP-SD 714  Olive latent ring...
Q8B5P7     12 CCGTLSFKVPKDAKKGKHLGTYDIRQALMDYGGLHSQEWCAKGIVNPTFTVRMHAPRNAFAGLSIACTFDDYKRIdL-AS 90   Tobacco ringspot ...
A0A9J8    580 LAGRGSVQVPKDCQAGKYLKTLDLRDMISGFSGIQYEKWITAGLIMPDFKVVIRYPANAFTGITWVMSFDAYNRI-T-SS 657  Arabis mosaic virus
Q6JX05    604 LAGRGSVQVPKDCRKDAFLKTLDMRSMTAGFAGIQYEKWITSGLCMPKFEVVIRYPPNAFTGLTWVMSFDAYNRI-T-TS 681  Grapevine deforma...
Q65624     45 IAHVVQGWVPKDATKGRVLEAINLREDIATSDNLVKYEWLAKGLIHPDLKLRMTVGQNPFVGISIGICCDYFGRLsKyYE 124  Blueberry leaf mo...
2Y7T_A     80 itaSADPVYTLSV 92  
Q86631    164 ---TFPSTLGQNM 173  Cherry leaf roll virus
ABM65096  349 agsRILNAVANVM 361  Tomato white ringspot virus
ABL84275  235 sdeVIAVPLAFQL 247  Blackcurrant reversion virus
ABN45882   89 lgaSFPVKLASLL 101  Tomato ringspot virus
Q9IV56    715 manELPPSVAFSL 727  Olive latent ringspot virus
Q8B5P7     91 lgsECPPSEMFEL 103  Tobacco ringspot virus
A0A9J8    658 istTASPAYTLSV 670  Arabis mosaic virus
Q6JX05    682 ittTASPVYTLSV 694  Grapevine deformation virus
Q65624    125 gdtALPIEVCNQL 137  Blueberry leaf mottle virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap