Conserved Protein Domain Family
UPF0183

?
pfam03676: UPF0183 
Uncharacterized protein family (UPF0183)
This family of proteins includes Lin-10 from C. elegans.
Statistics
?
PSSM-Id: 397645
Aligned: 22 rows
Threshold Bit Score: 354.319
Threshold Setting Gi: 754405549
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001949946  15 EQWEFVLGMHFCQAVAIIQSQVGIIKGVQVLYSDKNPLDIDLILDLPQDGIRFIFHPVFQRLKMIEIVNLKNIKLKYCGM 94  pea aphid
P34692        33 SQFEFVLGMPINQCIAMIQQHPRMLTKVELKYSKKDPFYQDIIIYIGSTGIRLYFDGLSQLIKLIEVDNLSMITLTYNDT 112 Caenorhabditis ...
CDQ02366      15 DYIELLLGMPINQAIAAIQNASRHIQNVELTYSSKEPLSRDVMIRLAKDGVRLYFEPNSQLLKLIEVYDLSNIILQYGGV 94  Brugia malayi
XP_002905255  13 GVGPFRLGASVAEVLHALKSRLP-VRPFEIAYDAVEPYKRDVVIESAEDGLRLHFDPVRQTLKVIEFYDVNRVALKFGRV 91  Phytophthora in...
EFJ28090      13 GIGAFSLGMPVCEALAYIEQHHSVFDVVHIKFNDEDPLQFDLVISFPEHGFHLRFEPRTQRLRLIEVYDVQRLQMRYATS 92  Selaginella moe...
Q9SD33        37 GIGPFSIGMPICEAFAQIEQQPNIYDVVHVKYYDEDPLKLDVVISFPDHGFHLRFDPWSQRLRLVEIFDVKRLQMRYATS 116 thale cress
XP_006657342  50 GVGPFTLGMPISDAFAQIESQPTLYDVVHVKYFDEEPLKLDFVISFPDHGFHLRFDPWSQRLRLIEIYDMKRLQLRYAKS 129 malo sina
EFC43326      11 SMGSFRIGMPISEAIQHLKHLDDKPNAVEILYNEKDPLNNDTIVKIVEEDIVLYFESKTQRLKLIQINNVKKVKLSYGAS 90  Naegleria gruberi
XP_011272825  57 gfndITLGSSLYDVLNQLTSQG---YHLNLIFSSKNPINVPYIIFIKELSTRLIFNGSNQILQFIEFTSFQNLRLHYQNH 133 Wickerhamomyces...
XP_009393684  36 gFGPFTLGMPLHEAFAQVDHQPNIYDVVHVKYFDEEPLKLDIVISFPDHGFHLRFDPWSQRLRLIEVYDVKRLQMQYATN 115 wild Malaysian ...
XP_001949946  95 VFNSPEVMPTIQQVEHTFGATHPGVFDAEKQTFTLNFRGISFCFNVDS-------KFQAGSAQCg-------LGSLQFAS 160 pea aphid
P34692       113 IFSDPNNMATLDRVNEFFGSTHPGSYDDKHNIYVQSWPGLSFCFPYGGens--nlEVRPGFGGN--------LRSLKYDA 182 Caenorhabditis ...
CDQ02366      95 VFSSPKDEADVNKVEGCFGATHPGVYVAEQSLYELSWKGLSFSFPTLNevs--kvQTSSVDATG--------LGSLQFRS 164 Brugia malayi
XP_002905255  92 VIFGGDISATFMSVYNLFGPTFPGRYDASEQSYVLGYEGGCVKFPIPAeyrnlyqNGID--------------LPMEFPN 157 Phytophthora in...
EFJ28090      93 SIGGPSVAATFVAVYALFGPTFPGSFDAKRNIYTLFYPGLAFTFPIPGqytnccqDREAE-------------LPIEFPD 159 Selaginella moe...
Q9SD33       117 MIGGPSTLATFVAVYALFGPTFPGIYDKERGIYSLFYPGLSFEFPIPNqytdcchDGEAA-------------LPLEFPD 183 thale cress
XP_006657342 130 LIGGPSTLATFVAVYGLFGPTFPGIYDKERGIYTLFYPGLSFAFPIPSqytnlftNGEVAD------------LPLEFPD 197 malo sina
EFC43326      91 IFSGPNVDASFVNIYNVFGPTYPGEFDTKSNTYKLTYPGLTFVFPIPPmfshlysDGKE--------------LPIEFPN 156 Naegleria gruberi
XP_011272825 134 KISSLGLKTIY---NNSFGPTYPGEIDGS--IYILSYPGISFRFKIPQtikdqeqDQNKIFIKIldeniefdTLVIHNEK 208 Wickerhamomyces...
XP_009393684 116 LIGGPSMLATFQAVYTCFGPTYPGTYDKDRGTYTLFYPGLSFAFPIPSqyayccrNVEAE-------------LPLEFPD 182 wild Malaysian ...
XP_001949946 161 GTSPNVSRVI--------IFSGSPLPg-----------qDILNiPSH--PL--SCYKGLTYLERLEVQRDLKN-TKGFMI 216 pea aphid
P34692       183 NSQPKLTKMS--------IYRGPNPS-------------EPES-VDT--PF--SCYCGQNRTRKVEAIWENGN-IVGIDI 235 Caenorhabditis ...
CDQ02366     165 NSPPLLAKMA--------IYPDSYNS--------------PKP-PRI--SA--ASLCGVICPVEVKSISDGSR-ISGLFF 216 Brugia malayi
XP_002905255 158 GATPAATGFV--------VFVGG----------------DYRS-PGL--PG----PTKKHYFEEVAVDIAEKKtS----L 202 Phytophthora in...
EFJ28090     160 GTTPVMSRVC--------IYDGALGGnveaganlaalikKAIP-PQL--PS------GSLYMEEVHAKLAED-------L 215 Selaginella moe...
Q9SD33       184 GTTPVTCRVS--------IYDNSSDKkvgvg----klmdRASV-PPL--PP------GSLYMEEVHVKPGKE-------L 235 thale cress
XP_006657342 198 GTTPVTCRVS--------IYDSSTDSkvgvg----slmdKAVV-PAL--PA------GSLYMEEVHAKLGEE-------L 249 malo sina
EFC43326     157 NTTPIATTIY--------LFHGHDLAk-----------------PKL--PPvkSESTPDSYYEPIIVNLGRG-------I 202 Naegleria gruberi
XP_011272825 209 NWNDVYEKIIninqdgyeLFDNKDIK------------------PRInkPS------SDISIDRIDINMPKGKiL----- 259 Wickerhamomyces...
XP_009393684 183 GTTPVTSRVC--------VYDGSSDSkvgvg----silnKATV-PPL--PA------GSLYMEEVHAKLREE-------L 234 wild Malaysian ...
XP_001949946 217 QLYLEGSg----sNRG----RKVTYNREINFGMSC------------QDVTSMLGTPSQIFYKSEDKMKIHSPNVHRHIS 276 pea aphid
P34692       236 QFDTQNG------RIVdgeyDVSTYTRQIYFGDSV------------SDVQSILGAPTKVFYKSDDKMKIHRGLHKETLY 297 Caenorhabditis ...
CDQ02366     217 IFAAETPlpdsssRKQa--fGLRKIEQSIFFGDTA------------ESVLSSLGAPSKVFYTKADRMLIHRGEDSRKLR 282 Brugia malayi
XP_002905255 203 VFSGR--------------------KQCIRLGWSP------------QEVISELGAPVSVFRKSED------PNDGATVA 244 Phytophthora in...
EFJ28090     216 FFTTS--------------------KKRLPFGASP------------QDVWAELGRPDGIHQKQVDPMVIHSASDPRPNS 263 Selaginella moe...
Q9SD33       236 YFTVG--------------------GQHMPFGASP------------QDVWTELGRPCGIHPKQVDQMVIHSASDPRPKT 283 thale cress
XP_006657342 250 LFTTG--------------------GQHIPFGASP------------QDVWTELGRPCGIHQKQVDQMVIHSASDPRPRT 297 malo sina
EFC43326     203 ELSYS--------------------KKKIKFGYST------------QDVLMILGAPDKIYYKRNDKLRIHAIGAGQSQT 250 Naegleria gruberi
XP_011272825 260 ----------------------------INFNDSTkpfeieinktyqQDILLKLGPPDDIFIKNDSRLKIHQTNQ----- 306 Wickerhamomyces...
XP_009393684 235 WFTVG--------------------NEHIPFGASP------------QDVWTLLGTPCGIHQKQVDQMMIHSASDPRPRT 282 wild Malaysian ...
XP_001949946 277 vPRRSDYFFNYFTLGFDILFDAKTH---KIKKFIVHTNFPGHYNFNIYHRCEFNIALTSEKSKFNLSNDCKkydkkskpi 353 pea aphid
P34692       298 -GP-PNFFFNYFVMGLDILFDFVSK---RVVKFVLHTNAPGHCDFGMYSRCNFSIFLNDKQY------------------ 354 Caenorhabditis ...
CDQ02366     283 -GPRPNYFFNYFSLGLDILFDCITN---RVQKFVLHTNLPGHFDFGIYARCNFCVTINGGP------------------- 339 Brugia malayi
XP_002905255 245 gGLVGEYFHNYPHLGLDILYN-SMH---RVSKVILKTNALGHPDFGAYNKCNFRLTFQSSSALQKSGISKRts------l 314 Phytophthora in...
EFJ28090     264 -ALCGDYFYNYFARGLDILFDGQTH---RIKKFVLHTNFPAHTDFNSYIKCNFVIHCPLTGSDEKDSHY----------- 328 Selaginella moe...
Q9SD33       284 -TICGDYFYNYFTRGLDILFDGETH---KVKKFVLHTNYPGHADFNSYIKCNFVISAGADAAEANRSGN----------- 348 thale cress
XP_006657342 298 -TLCGDYFYNYFSRGIDILFDGQTH---RIKKFVLHTNFPGHSDFNSYMKCNFVIY-------DTEAEGTDqpgn-ipkn 365 malo sina
EFC43326     251 --VGNDYFYNYFSMGFDIMFGGNTH---TVQKIMLHTNFPGSVDFNTYSKCNFSIPVSQFEFQEKRENQ----------- 314 Naegleria gruberi
XP_011272825 307 -TSDSEVFHNYFKFGIDILYNISSKngsRVKKFIIHNNLPNSLNFQKYKKCIWRMLGYPQQPQTTSEDNWDwird--knq 383 Wickerhamomyces...
XP_009393684 283 -TRCGDYFYNYFTRGLDILFDGQTH---KIKKFVLHTNFPGHSDFNSYVKCNFVIY-------DADVEGIIqpgs-ttkn 350 wild Malaysian ...
XP_001949946 354 TVNTFTKWDEISEKL-KH--SERPVVLNRGS---SENST--------------NPFGSTFCYG-YQDMVFEVMQ-NQHIA 411 pea aphid
P34692       355 EIRTDSKFDEFSHAFmNDsnPPRPVVLARQE-------Q--------------QPFGSTFCYG-IKQIIVERTE-NGFLT 411 Caenorhabditis ...
CDQ02366     340 TITPSSKREDFFGAFcGDt-AVQPVVLSRSG------TE--------------NPFGSTFCYG-TDQVIVEVMD-NGFIA 396 Brugia malayi
XP_002905255 315 EITPQTPWEDIRLVFkSSs-DLRPIVLDNGL------GL--------------HPFGASLCYSpTPGCTFEVMK-NGFIA 372 Phytophthora in...
EFJ28090     329 VITGDTKWPQIQQLLgDA---GRAAIQTQGS------VS--------------NPFGPTFVYG-YRNIAFEVMK-NGHIA 383 Selaginella moe...
Q9SD33       349 KITPSTNWDQVKEILgEC---GPAAIQTQGS------TS--------------NPFGSTYVYG-YQNVAFEVMK-NGHIA 403 thale cress
XP_006657342 366 CITPRTKWEQVKEILgDC---GRAAIQTQGS------MN--------------NPFGSTFVYG-YQNIAFEVMK-NGYIA 420 malo sina
EFC43326     315 FIGPDEKFSNVQKILdGTp-CSKPIVHDHTK------AN--------------NPFGGTKFFA-FRNCIFEVISrNDHIN 372 Naegleria gruberi
XP_011272825 384 FITSEMYFNEIPKNYkTNg-SNLPIILNRFDlinNLDQSieiiddmdekgdqgDNHGQSLIYA-YKRCIWEIID-NAAIN 460 Wickerhamomyces...
XP_009393684 351 CITPSTKWEQVKEILgDC---GPAVIQTPGA------TN--------------SPFGSTFVYG-YQNVAFEVMK-NGYIA 405 wild Malaysian ...
XP_001949946 412 SITFY 416 pea aphid
P34692       412 SVTIY 416 Caenorhabditis elegans
CDQ02366     397 SVTLF 401 Brugia malayi
XP_002905255 373 SVTLT 377 Phytophthora infestans T30-4
EFJ28090     384 TVTLF 388 Selaginella moellendorffii
Q9SD33       404 TITLF 408 thale cress
XP_006657342 421 TVTLF 425 malo sina
EFC43326     373 SLTLF 377 Naegleria gruberi
XP_011272825 461 SVTLY 465 Wickerhamomyces ciferrii
XP_009393684 406 TVTLF 410 wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap