5O5Q


Conserved Protein Domain Family
ATP_bind_2

?
pfam03668: ATP_bind_2 
Click on image for an interactive view with Cn3D
P-loop ATPase protein family
This family contains an ATP-binding site and could be an ATPase (personal obs:C Yeats).
Statistics
?
PSSM-Id: 397641
Aligned: 4 rows
Threshold Bit Score: 488.168
Threshold Setting Gi: 2811049
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5O5Q_A  12 MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDLARTLA---DREISAAVSIDVRNMPESPEIFEQAMSNLPD- 87  Escherichia coli
P45071   1 MEIIIISGRSGAGKSVALRALEDAGYYCVDNIPLDLLPQLTDILS---QSQSSVAISLDIRNIPNSAHSLKQTLSTLQK- 76  Haemophilus influenza...
P9WFQ3  17 IDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDFGLaagSRITQLAVVMDVRSRGFTGDLDSVRNELATR- 95  Mycobacterium tubercu...
O06973   9 IQLVIITGMSGAGKTVAIQSFEDLGYFCVDNLPPSLLPKFLELMKesnSKMSKVALVMDLRGREFFDRLIEALDEMAENp 88  Bacillus subtilis sub...
5O5Q_A  88 AFSPQLLFLDADRNTLIRRYSDTRRLHPLSSKNLSLESaIDKESDLLEPLRSRADLIVDTSEMSVHELAEMLRTRLLGKR 167 Escherichia coli
P45071  77 HHQIKIIFLEADRATLIRRYSDSRRLHPLSLKDLSLEAaIDEEYRYLEPLIQHANLILDTTHLSTHSLAERLREFLRGNS 156 Haemophilus influenza...
P9WFQ3  96 AITPRVVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEG-IAAERRMLAPVRATADLIIDTSTLSVGGLRDSIERAFGGDG 174 Mycobacterium tubercu...
O06973  89 WITPRILFLDAKDSILVTRYKETRRSHPLAATGLPLEG-IALERELLEELKGRSQIIYDTSDMKPRDLREKIVKHFATNQ 167 Bacillus subtilis sub...
5O5Q_A 168 ERELTMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQTRSYLELWLPMLETN 247 Escherichia coli
P45071 157 EKELKIIVESFGFKYGIPLDADYVFDVRFLPNPHWDPTLRPMTGLEAPVAEFLNSHTEVNEFIYLTRHYIDTWLPMLEKN 236 Haemophilus influenza...
P9WFQ3 175 GATTSVTVESFGFKYGLPMDADMVMDVRFLPNPHWVDELRPLTGQHPAVRDYVLHRPGAAEFLESYHRLLSLVVDGYRRE 254 Mycobacterium tubercu...
O06973 168 GETFTVNVMSFGFKYGIPIDADLVFDVRFLPNPYYIESMRPLTGKDKEVSSYVMKWNETQKFNEKLIDLLSFMLPSYKRE 247 Bacillus subtilis sub...
5O5Q_A 248 NRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQ-SRHRTLEKR 293 Escherichia coli
P45071 237 NRSYLTIAIGCTGGKHRSVYIAQQLGEYFQAKGKTVK-IQHKSLERN 282 Haemophilus influenzae Rd KW20
P9WFQ3 255 GKRYMTIAIGCTGGKHRSVAIAEALMGLLRSDQQLSVrALHRDLGRE 301 Mycobacterium tuberculosis H37Rv
O06973 248 GKSQVVIAIGCTGGQHRSVTLAENLADYFKKDYYTHV--THRDIEKR 292 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap