Conserved Protein Domain Family
UPF0121

?
pfam03661: UPF0121 
Uncharacterized protein family (UPF0121)
Uncharacterized integral membrane protein family.
Statistics
?
PSSM-Id: 397636
Aligned: 21 rows
Threshold Bit Score: 195.576
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCD78507      12 QQQNTLLSRLKSDYINTAMYFARLGTLFCCVVFFFaPIFSRshPSDlevWY-RRALLASAATSALRLHQRIkSLNtGFSR 90  Schistosoma man...
EEC16272      15 RGFSEVINHLSIHKIESLLWFTRMCTVVFTLLYII-PILGAn-PYT---CY-QRALISNAATSALRLHQRM-PTI-QLSR 86  black-legged tick
Q9XWV0        33 PAYSSISQYVSANTMECVLFAARVLTVFFALNYMI-PFIGLvpAHS---AY-YKIFAASAATFALRLHTRIqGQF-ALNA 106 Caenorhabditis ...
2_pfamImport   4 QTYSSISQYVSAHTMECVMFAARVLTVFFALNYMI-PFIGFipPHS---AY-YKLFTASAATFALRLHTRIqGRL-ALNA 77 
XP_004348619 121 AARRSLVQFAIANKLQLIAWIANLLCLINVLAFIV-PIGMDpsPIS----Y-YKVFRRGAVAYIVMLYQRH--GL-VFSR 191 Capsaspora owcz...
4_pfamImport   4 TSLKSFLIGSKINMFQLFQFALRSLLLLYFVSFWI-PVLLS--SYVayvNF-FKVALINHASYLAFIHG----VP-RWSA 74 
XP_007407318  14 SSK-------RMSYMHLAWSLGHILVLLSTIWTFLgALFFKsrSTS----Y-YIACSGAILSWSIVVYKSL-GIP-SFSR 79  Melampsora lari...
Q803C2        14 PPQAGAAQFLLSNKLETAMWLSRLFTVYCSIMFIL-PLLGPqaAAN---FY-QRALLANALTSALRLHQRL-PHF-QLSR 86  zebrafish
EKC27828      95 qrpnTVLNFMLSNKVEAALWLTRIFTVVCSFLFIF-PILGGn-PYG---FY-QRALISNAATSALRLHQRL-PHF-QLSR 166 Pacific oyster
XP_002129462  18 RDTGSIMNFMAARRIGTAMWVMRCYAIFLSIQYMF---FCSafDMG---HYfQRAMLANGVVCALRLHQRV-PQF-RLTR 89  vase tunicate
CCD78507      91 EVLEVLISEDSSHYLLFSIMFAVLPPVTVSLVPIFLFALLHVASFTRVLLNasvslnsggtsdgsdapVGSSNMS--CVH 168 Schistosoma man...
EEC16272      87 MFLSQLLIEDSCHYLFFSLIFLFAQPMTLVLLPVFLFALLHSASFTLTLLD-----------------KFGGRSG--FLG 147 black-legged tick
Q9XWV0       107 QFIQRLIIEDSFHYLVYSVVFLMAAPVSMAALPVTIYAALHACTFMTKILR-----------------ETGHTSS--IIP 167 Caenorhabditis ...
2_pfamImport  78 QFLQTLVVEDAFHYLIYSVVFLMAAPVSMAALPVTIYAALHSSTFFVKIMR-----------------STGHNLP--LLQ 138
XP_004348619 192 NYLNSIIPDENFAYIMYCVVFSFADVHAAAVLPMAIFALYGFATFTPNVASail------------pqNLRSTIV--PRI 257 Capsaspora owcz...
4_pfamImport  75 MYAERLFLDPATQALFFCLVFFFSPPYSLAMVPVFLQDMVHYSTYLQSLLQ-----------------VLGLADTk---- 133
XP_007407318  80 AYFQRAAMDENVQYLAVALYWFFSKPIYVTLLPFAIFSTFHSLTFVRTSLLpkipspkkdatgastssGTGSEGPqqVAI 159 Melampsora lari...
Q803C2        87 AFLAQALQEDSCHYLLYSLILVNSYPITMSIFPVFLFSLLHATTYTKKVLD-----------------TMGPNSL--MFV 147 zebrafish
EKC27828     167 EFFGLLFLEDSCHYLMFSLIFMNGYPITMAVIPVFLFALLHACNYTKNILN-----------------VMGPDSL--QFM 227 Pacific oyster
XP_002129462  90 VHFSMLLQEDSAHYLIYSLIFLTCHPITIALMPVAVFALLHASSFTRQMID-----------------MHGSNSY--PFA 150 vase tunicate
CCD78507     169 HILqklIVKVNAHDQN---IL------------------------RIIALNEI-MLMVICIFMAVSGPRIFILPFI-YYP 219 Schistosoma man...
EEC16272     148 TWL---VLLLEHQSNN---IL------------------------RLVAFTEI-FLMPLTIFSLLSGRSSLVTPFV-YYR 195 black-legged tick
Q9XWV0       168 KLE----QFTAHQTQN---AL------------------------GIIACSEI-FLVPLLVSLIFSGKGSLLLPFA-YYR 214 Caenorhabditis ...
2_pfamImport 139 KIE----QFNTAQTQN---AL------------------------GIIACSEI-FLVPLLVSLIFSGKGTLLLPFA-YYR 185
XP_004348619 258 RGLvarLTAVGDQAKI------------------------------AAARLEL-ILVPILFIGLFSGE---FLPLIsYAN 303 Capsaspora owcz...
4_pfamImport 134 -----vVTLVASKALVpltALiirdpsfptlatsakwvklysripQVAANIDL-AIGFAMIVELLLPSRNFLLLVL-YWQ 206
XP_007407318 160 AVSrsiQNWVKQNYES---AM------------------------YLVAIIEVvVIQGRVTVGALLFQNSFLHPLF-FAH 211 Melampsora lari...
Q803C2       148 RNF---LNKLTSNQQN---IL------------------------KFIACNEI-FLMPATVFMLFSGQGSLLQPFI-YYR 195 zebrafish
EKC27828     228 RKL---IDKLQLQQIN---IL------------------------RFIACTEI-FIMPAIIFMMFAGKCSFFLPFV-YYK 275 Pacific oyster
XP_002129462 151 RKL---INHVAKHQAT---LF------------------------RFVALNEV-LILPTVVAMLIMGRASVFAPFL-YYK 198 vase tunicate
CCD78507     220 FLKMRYNSRRNPYTRNAFSELRVALQNVAYHTKCPALISRIIYGLINIVSRLGTS 274 Schistosoma mansoni
EEC16272     196 FLSLRYASRRSPYSRTVFHELRLVTEHYASRPGCPAFLSRLLYKTIGLICQLSPP 250 black-legged tick
Q9XWV0       215 FLSLRYASRRNPSTRQAFAQMRGSLQNVAMSSSCPRPISSLIYRAIDFISARAPP 269 Caenorhabditis elegans
2_pfamImport 186 FLSLRYASRRNPSTRQAFYQMRVSLENVAQSTSCPGPVRGFIHRAIGFISSRAPP 240
XP_004348619 304 FLNLRYV--QSAHTRRLLSDLKILGFQLTGHPRCPPIIGAAFVKLVGLLERMDPN 356 Capsaspora owczarzaki ATCC 30864
4_pfamImport 207 VMRVRYM--ISPQLQEAFRSLHASIFTIVNHPRCPAVIPSIYEKIRAFVAKTG-- 257
XP_007407318 212 FLRLRFY--LSPQTRAALSAVNTTIDHYLNHPSCPGAAKTGVNVVRNLIIQYads 264 Melampsora larici-populina 98AG31
Q803C2       196 FLTLRYSSRRNPYCRTLFTELRILLEHFVMKPSCPVFFRRMCLNSIAFVSRLAPT 250 zebrafish
EKC27828     276 FLSLRYTSRRNPYCRTLFTEMRLTVEHFTATPSCPGIIRTACLKAIAFISRLSPP 330 Pacific oyster
XP_002129462 199 FVHYRYLSTRNPYSRVIFYELRMSAEVLSRNPNCPSILSSSLLKGITFVSKLApp 253 vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap