5ZWO


Conserved Protein Domain Family
PHF5

?
pfam03660: PHF5 
Click on image for an interactive view with Cn3D
PHF5-like protein
This family of proteins the superfamily of PHD-finger proteins. At least one example, from mouse, may act as a chromatin-associated protein. The S. pombe ini1 gene is essential, required for splicing. It is localized in the nucleus, but not detected in the nucleolus and can be complemented by human ini1.
Statistics
?
PSSM-Id: 397635
Aligned: 39 rows
Threshold Bit Score: 126.182
Threshold Setting Gi: 70883851
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ZWO_5                 1 MSRHQF-DLIMCLKQPGVQTGLLCEKCDGKCPICDSYV------RPKRKVRVCENCSFGKQ--AKNCIICNLnVGVNDAF 71  Sacchar...
CCE61410               1 MSRHQF-DLVMCMRQPGTHIGMVCDKCDGKCPICDSYV------RPKSKVRICEQCSFGNT--KTYCIICGL-PGTSEAY 70  Tetrapi...
XP_002496395           1 MSRHQF-DLVMCMRQPGTHVGLLCEKCDGRCPICDSYV------RPKSKVRICGQCAFGKS--GNSCIICGA-PGLTEAY 70  Zygosac...
CAR24243               1 MSRHQF-DLVMCLKQPGTHIGKLCDKCDGKCPICDSYV------RPKSKVRICEQCSFGAN--WKKCIICGQ-MGTSDAF 70  Lachanc...
CCK68397               1 MSKHQF-DLVVCLKQPGSHLGVLCDKCDGRCPVCDSHIlntqhkRAIHKVKICESCAFGKS--GTKCIICGMaNAHNTAY 77  Kazachs...
XP_003958614           1 MSRHQF-DLVMCMKQPGTQIGLLCDKCDGKCPICDSFIddn-tiRLKKRVRICQTCSFGKQ--SYSCITCGSnLAHHEAF 76  Kazachs...
Q75DC3                 1 MSRHQF-DLVMCMKLPGTSIGRLCERCDGKCPSCDSNV------RPLSKVRICDQCSFGGQ--GKKCILCGS-IGVSDAY 70  Eremoth...
LoveMIT:GQ68_03628T0   1 MSRHQY-DLVQCFKQPGTTIARLCDKCDGRCPSCDSYV------NQAELAYICDECSFVSNkgEGKCILCGS-KSTTDAY 72  Komagat...
EAY16824               1 --mmNP-DSIKCGGRPGPEFGLVCEACEGRCPICNAPVk----eDRCVPVHICGECSFGQL--RDKCIVCSA-PAKYKAY 70  Trichom...
EAN96740               1 MLRHSKqEQQMCRKMPGASFGYVCDQHDGRCVICDLQFde--vlPSMREVHVCDDCGFGKEg-EERCIMCNSgKTTEVAY 77  Trypano...
5ZWO_5                72 YCWECCRLGKDKDGCPRILNLGSNRLDRHFEKKK 105 Saccharomyces cerevisiae S288C
CCE61410              71 YCWECCKLEKHRDGCPRIINIGSNKVDKYFENKN 104 Tetrapisispora phaffii CBS 4417
XP_002496395          71 YCWECCKLEKNRDGCPRITNVGSNRTDRHFEKKS 104 Zygosaccharomyces rouxii
CAR24243              71 YCWECCRLEKNKDGCPKILNVGSNRTDKHFEKKA 104 Lachancea thermotolerans CBS 6340
CCK68397              78 YCWECSRQEKSKDGCPKVLNTGSNTVDRHFELKN 111 Kazachstania naganishii CBS 8797
XP_003958614          77 YCFECCKLEKDKDGCPRIINVGSNTVDKHFLNk- 109 Kazachstania africana CBS 2517
Q75DC3                71 YCWECCKLEKDRDGCPRILNVGSNKTDRHFDRKL 104 Eremothecium gossypii
LoveMIT:GQ68_03628T0  73 YCSECVMTEKDRDGCPRILNIGTTRSDLFYEKRK 106 Komagataella phaffii GS115
EAY16824              71 YCEQCSLLGKDRDGCPRIINVGINRSDRFYERKR 104 Trichomonas vaginalis G3
EAN96740              78 YCHYCVALEKDRDGCPRVLN--QSRHQRMATLrt 109 Trypanosoma cruzi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap