Conserved Protein Domain Family
UPF0014

?
pfam03649: UPF0014 
Uncharacterized protein family (UPF0014)
Statistics
?
PSSM-Id: 397628
Aligned: 170 rows
Threshold Bit Score: 123.733
Threshold Setting Gi: 283946860
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9WY36                9 LIQLLSAYIFVVVLMLILRIRRIPREKEVLVASIRMTFQLVMAGFVLSYILDHPSPLYTILAVLVMEIFAIYNVYKRARL 88  Thermoto...
jgi:Shew_0630        13 WLALALFMLVLLVPLGIGRLFNLKLGGEMLLATARMTAQLLLVGFYLKFLFSLESLWVNLLWLSVMLLVGASAILGGARL 92  Shewanel...
WP_013049835          9 WPELALFMLVLVIPFSIDRYLKLDLGKEIITAVFRMTAQLILVGLYLQFLFELNSLLLNLLWLTMMLLIGASAIIGSAKL 88  Shewanel...
Q7MLQ4               39 WGALLAFSSLLVIPLIISHCYQLAIAKEALLSVGRMALQLILVGFYLEYLFTLNDWRINVIWLLVMLTVGASSIVSKAHL 118 Vibrio v...
JLExeter:vfu_A01645   9 WWQLVLFSTLLAIPLAVNAYHQLDIGKEMLWSIGRMALQLLLVGIYLEYLFEHNSLWVNLAWLMVMIGVGASSIVSKAKL 88  Vibrio f...
HusnBIG:Mpsy_2524     8 LTGMVFCFLLLLIPVLISHHLQLQLVGSTIEGAFRMTVQLVFVGFFLTFVFDLNSSVLNIFWVMIMVIVASYTVLKNSSL 87  Methanol...
WP_022391030          9 WGSMCLGFLLLLIPVTALAYYRTGLVKDTLIAASRMTLQLFLIGFYLEYLFTWNSAWINLLWVIVMICVASWTVLGRTKL 88  Tannerel...
WP_021980585          8 YTGLAVGMLLMLIPFYFLWRFRTGLLSSALWGTVRMTVQLLLIGVYLRFLFQWDNEWVNVLWMAVMAVIASHTAVSRTAL 87  Paraprev...
WP_006744927          8 FLSLGIGLLLSFIPLYYLWKFKTGLVKATAIAIIRMIVQLFFVGMYLKYLFLWDNPWINILWVVVMIFVASHTALARTRL 87  Bacteroi...
CCY47919              8 yLSLFTGLLLLIIPVFYLWKFKTGLLKATLIGTARMIVQLFLIGMYLKYLFLWNNPWINFLWVIIMIFVAGQTALSRTGL 87  Bacteroi...
Q9WY36               89 SLPARVKkrlelFIAISVSTGTLLSLVYFLYVVVRISPWFDPRYVIPLAGMIIGNSMTGVSLGVKTLSESITIQKDIVEA 168 Thermoto...
jgi:Shew_0630        93 PKARLML-----PLLFSLSLSLLPLLTLLLLALLQPSPVYQAQYLIPLAGMLLGNSLSGNILALQRLFNAFEEKQEDYQG 167 Shewanel...
WP_013049835         89 PKRRLYL-----PIITGLVVGITPLIAILLLALLKPAPLYSAQYMIPMAGMLLGNCLSGNIVALQRLFSAFDEQKDQYEG 163 Shewanel...
Q7MLQ4              119 PQSQLLF-----PTLFGLAGGMLPILSVLLVGIIVPTPWYHTQYMIPLAGMLLGNSLSGNIVALQNLFDCYRNRRNEYEA 193 Vibrio v...
JLExeter:vfu_A01645  89 PVTLLIG-----PIVIGLAVGLFPLIILLCVAVVQPTPWYSAQYMIPLAGMLLGNSLSGNIVALQNLFTAYQERRAEYEG 163 Vibrio f...
HusnBIG:Mpsy_2524    88 KYGSLIM-----PLTLSFALANIGVLLYFNSFVIALSDLFEARYFIPIAGMVIGNSLRANIVGINDFCDQIQRNENRYLS 162 Methanol...
WP_022391030         89 PVKQLFI-----PVIVAFFCSICIIDVYFLGIIIKLDHLFEARYFVPVSGMILGNMLSANVIALNAFYGSLDRERQLYFY 163 Tannerel...
WP_021980585         88 RREVLLL-----PVFTGFLATVLLVSLYFLAFVVRADDVFAARFFIPVAGVLFGNMLTVNIMAVNVYYSELQREQDMYYY 162 Paraprev...
WP_006744927         88 KRSVLMI-----PIVIGFLFSVITIGVFFLGIVLQIDNIFDAQYFIPIFGILMGNMLSSNVIALNTYYSGLQREQQLYYY 162 Bacteroi...
CCY47919             88 KRKILLI-----PISVGFLCSVVLVGMYFIGIVLQLDNVFSAQYFIPIFGILMGNMLSSNVIALNTYYSGLKREEQLYCY 162 Bacteroi...
Q9WY36              169 ALMLGARPKDAVRMFSDRAFDSAILPTLNSMIGMGIVFLPGMMTGQILSGASPITAIKYQIAIMLGILGEVTISVSVFLY 248 Thermoto...
jgi:Shew_0630       168 RLALGATPWQAAFPFIQGALQQALAPSIAAMSTMGLVTLPGMMTGQILGGSDPLVAVKYQVVIMLAILVMQSMSVASALS 247 Shewanel...
WP_013049835        164 ALALGASPYQASFPFMQSALKQSFAPILASMTTTGLVTLPGMMTGQILGGIDPMVAIKYQLIILVAIFVMLTVSVTLSLI 243 Shewanel...
Q7MLQ4              194 AIALGASPRYASLLFVRQAMQKSFAPILASMAATGLVTLPGMMTGQILGGASPMVAIKYQLIIMIAIFVTLTLSVVITLE 273 Vibrio v...
JLExeter:vfu_A01645 164 ALSLGASPIYASRGFVRSALRKASAPLLASMAATGLVTLPGMMTGQILGGTSPLIAIKYQLLIMIAIFVMLNISLTLSVH 243 Vibrio f...
HusnBIG:Mpsy_2524   163 SLSLGAEKYEALKPYLRKSLRNSIRPTLANMATVGIVFLPGMMTGQIIGGSSPLTAIEYQIAIMIAIYVATVMNVMLCVL 242 Methanol...
WP_022391030        164 LLANGATRGEATAPFMREALIKSFNPTIASMAVMGLVALPGTMTGQILGGSSPNVAIKYQIMLMITIFSSSLISVLLTLW 243 Tannerel...
WP_021980585        163 LLGNGATRFEATLPFLRSAVIKSFSPCIANMAVLGIVSFPGTMIGQILGGSMPEVAIKYQLMISVITVVASMLSLVITIS 242 Paraprev...
WP_006744927        163 LLGNGASQKEARAPFIGQAMIKAFSPLIANMAVMGLVALPGTMIGQILGGSSPNVAIKYQMMIVVINFTASMLCLMITIT 242 Bacteroi...
CCY47919            163 LLGNGATRQEAQAPFIRQAIIKAFSPLIANIAVMGLVALPGTMIGQILGGSSPNVAIKYQMMIMVITFTASMLSLMITIS 242 Bacteroi...
Q9WY36              249 LGYKAFF 255 Thermotoga maritima
jgi:Shew_0630       248 LAVRQCL 254 Shewanella loihica PV-4
WP_013049835        244 Ltiksci 250 Shewanella violacea
Q7MLQ4              274 LVLHrcl 280 Vibrio vulnificus YJ016
JLExeter:vfu_A01645 244 LTlrval 250 Vibrio furnissii NCTC 11218
HusnBIG:Mpsy_2524   243 ILMYRGF 249 Methanolobus psychrophilus R15
WP_022391030        244 AAKRrsf 250 Tannerella sp. AM09-19
WP_021980585        243 LSVRRTF 249 Paraprevotella clara
WP_006744927        243 lssnstf 249 Bacteroides coprosuis
CCY47919            243 LASRKSF 249 Bacteroides sp. CAG:189
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap