2LOS,2LOO


Conserved Protein Domain Family
Tmemb_14

?
pfam03647: Tmemb_14 
Transmembrane proteins 14C
This family of short membrane proteins are as yet uncharacterized.
Statistics
?
PSSM-Id: 397626
Aligned: 216 rows
Threshold Bit Score: 32.122
Threshold Setting Gi: 357122628
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2LOS_A        21 WFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLgayqlsqdprnvwVFL---------------------ATSG 79 
XP_002271868 220 YLGIPYGVALSVGGLLSFMLTGSIPAVRFGVILGGALLA-------------LSIsslrawkkge-slalalkgqtAIAG 285 wine grape
XP_002308255 211 HLGIPYGLLLSTAGFLSFMLSGSISSLRFGVILGGMLLA-------------LSVsslksykrae-pyslalkgqaAIAA 276 black cottonwood
EFH56011     205 HVGIPYGLLLLVGGFINFMVSGSIPAIRFGVILGGALFA-------------LSLaslkshrkge-sstkflkgqmAIVA 270 Arabidopsis lyr...
KRH00438     200 YVGVPYGLMLSLGGFLSFMVTGNTAAIRFGVILGGVLLA-------------LSIlslksykkgr-tsplalkgqaAIAS 265 soybean
XP_003529052 165 YVGVPYGLVLSVGGFVSFMVTGSIAALRFGIVLGSVLLA-------------LGVsslraykrgq-psslmlkgqtAIAS 230 soybean
EEF33682     193 HVGIPYGLLLSSGGFLSFMLTGSISAIRFGMILGAALLA-------------LSIsslksfkkgq-ahagalkgqtAIAA 258 castor bean
XP_009395167 197 YFGIPYGSFLVIGGFMYFMLTGSIPAIRFGVVLGTAILA-------------LSVsslrswkngk-ttpllligqtAISA 262 wild Malaysian ...
ACF88465     206 HVGIPFGTFLTVGGFLNFMLAGSTSALRFGIILGLALLA-------------LGIsslrsqrdggrrprllvkgqaAIAS 272 Zea mays
XP_006341302 194 YVGIPYGTLLSAGGFLYFMLSGSTAALRFGVVLGGALLA-------------LSVsslrswrsge-stslalkgqaAIAT 259 potato
2LOS_A        80 TLAGIMGMRFYHSGKFMPAGLIAGASLLMVA 110
XP_002271868 286 IIFLREIC-LLSQKPSFSTRLATIISGAMVA 315 wine grape
XP_002308255 277 IIFLRDISIILTRRTSFLTPLATLISGAMAA 307 black cottonwood
EFH56011     271 IIFLRELRLLLSQKSTFLGFFTTLTSGGVLA 301 Arabidopsis lyrata subsp. lyrata
KRH00438     266 ILFLREISSIGKGS----SYFTALISGAVVA 292 soybean
XP_003529052 231 ILFLREIRLLAAEGSPLVTYFTSLISGAVVA 261 soybean
EEF33682     259 VIFLREIG-FLFERASLFTFFSTVIRFIMls 288 castor bean
XP_009395167 263 IIFCRQWL-LCSQRGSFPNLLLLLISGMMAG 292 wild Malaysian banana
ACF88465     273 VIFFREFS-VLLQNGWFPKIFMVLLSGVVAG 302 Zea mays
XP_006341302 260 ILFVREFR-LMLQKPFIFNFITATISGGVAA 289 potato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap