6VAB


Conserved Protein Domain Family
Vps35

?
pfam03635: Vps35 
Vacuolar protein sorting-associated protein 35
Vacuolar protein sorting-associated protein (Vps) 35 is one of around 50 proteins involved in protein trafficking. In particular, Vps35 assembles into a retromer complex with at least four other proteins Vps5, Vps17, Vps26 and Vps29. Vps35 contains a central region of weaker sequence similarity, thought to indicate the presence of at least three domains.
Statistics
?
PSSM-Id: 397615
Aligned: 116 rows
Threshold Bit Score: 583.706
Threshold Setting Gi: 365982914
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6VAB_B             15 LLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRK-VAD 93 
XP_003288783       22 FFEEAKNNVMIQGHHMKLSLDNSKLMDALKYASNIINELRTSLLSPKSYYALYLVAFDYLQYLNTYLYEE-KHGKR-MIE 99  Dictyostel...
XP_009121078       13 WLAAGAAAFKQNAFYMQRAIDSNNLKDALKYSAQMLSELRTSKLSPHKYYDLYMRAFDELRKLEIFFMEETRRGCS-VIE 91  field mustard
XP_002877795        9 WLAAAIAAVKQHAFYMQRAIDSNNLKDALKFSAQMLSELRTSKLSPHKYYELYIRVFNELGTLEIFFKEETGRGCS-IAE 87  Arabidopsi...
XP_002466271       22 WLAEGIAGVQQNAFYMHRALDSNNLKDALKYSAQMLSELRTSRLSPHKYYELYMRAFDEMKKLEMFFREETRRGSCsVVD 101 sorghum
EFH65306           13 WLAEGIAGIQHNAFFMHRALDANNLREVLKYSALMLSELRTSKLSPQKYYDLYMRAFDQLRQLEIFFKDESRHGLP-VVD 91  Arabidopsi...
EFJ27365           16 WLADAMALVQHNAFFMHRALDNNNLRDALKYSAQMLSELRTSKLSPQKYYELYMKSFDELRKLEFFFKDETKRGRT-NAD 94  Selaginell...
XP_001418970       17 WLDEAKASVKEHAFRMKRAADEDNLREALKCASLMLGELRATTPAPRGYYELYIAASDELMHLRRFFGDKSRHGRS-CVE 95  Ostreococc...
EEH58100            1 -LADAQSQVKQYAFYMKRALDDGNLRESLKQCSLMLGELRTIALSPQKYYELYMHVSGELSHLEMFFAEPSRHRKS-NLE 78  Micromonas...
jgi:MICPUN_105123  15 WLADASSLVKQYAFYMKRALDDNNLREALKQGSLMLGELRTIALSPQKYYELYMQVWNELRHLEAFFGEEARHGKS-NLE 93  Micromonas...
6VAB_B             94 LYELVQYAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPtDEETT 173
XP_003288783      100 LYEVVQHAGNVLPRLYLLITVGSVYIKTKQAPAKDVLKDLIEMCRGVQHPTRGLFLRHYLSEVTKDKLPDVDSP-A--EA 176 Dictyostel...
XP_009121078       92 LYELVQHAGNILPRLYLLCTAGSVYIKTKEAPAKEILKDLVEMCRGIQHPLRGLFLRSYLAQISRDKLPDIGSE-YEGDA 170 field mustard
XP_002877795       88 LYELVQHAGNILPRLYLLCTIGSVYIKSKDVTATDILKDLVEMCRAVQHPLRGLFLRSYLAQVTRDKLPSIGSD-LEGDG 166 Arabidopsi...
XP_002466271      102 LYELVQHAGNVLPRLYLLCTVGSVYIKSKEAPAKDVLKDLVEMCRGIQHPLRGLFLRSYLSQISRDKLPDIGSE-YEGDA 180 sorghum
EFH65306           92 LYELVQHAGNILPRMYLLCTVGSVYIKSKQAPSKDVLKDLVEMCRGVQHPIRGLFLRSYLAQVSRDKLPEIGSD-YEGDA 170 Arabidopsi...
EFJ27365           95 LYELVQHAGNILPRLYLLITVGSVYIKSKEAPAKDVLKDLVEMSRGVQHPIRGLFLRSYLAQVSRDKLPDVGSE-YEGEG 173 Selaginell...
XP_001418970       96 LYELVQHAGNILPRLYLLITVGATYVELGEGSARDVLMDLVEMTRGVQQPMHGLFLRAYLSQMSKGLLPDKGSR-YEGEG 174 Ostreococc...
EEH58100           79 LYELTQHAGNVLPRLYLLITAATVYVKSKEGKAKDVLKDLVEMAKGVQQPIHGLFLRAYLTQISRTLLPDAGSP-YEGEG 157 Micromonas...
jgi:MICPUN_105123  94 LYELVQHAGNILPRLYLLITVGVVYIKSKDGAAKDVLKDLVEMAKGVQQPIHGLFLRTYLSQASKTLLPDTGSE-YEGNG 172 Micromonas...
6VAB_B            174 GDISDSMDFVLLNFAEMNKLWVRMQhqgHSRDREKRERERQELRILVGTNLVRLSQLEGVNVERYKQIVLTGILEQVVNC 253
XP_003288783      177 GTVMDSIDFIIQNFTETNKLWVRMQhqaPTKDKERRENERLELRLLVGKNLSRLAQLDGVNQETYSEVVLPKVVEQIINC 256 Dictyostel...
XP_009121078      171 DTVTDAVEFVLLNFTEMNKLWVRMQhqgPARDKEKREKERSELRDLVGKNLHVLSQLEGVDLDMYRDTVLPRVLEQIVNC 250 field mustard
XP_002877795      167 DAHMNALEFVLQNFTEMNKLWVRMQhqgPSREKDKREKERNELRDLVGKNLHVLSQLEGVDLGIYRDTVLPRILEQVVNC 246 Arabidopsi...
XP_002466271      181 ESINDAVEFVLQNFIEMNKLWVRMQhqgPVREKEKRGKERNELRDLVGKNLHVLSQIEGVDLDMYKETVLPRILEQVVNC 260 sorghum
EFH65306          171 NTVMDAVEFVLQNFTEMNKLWVRIQhqgPGTVREKQEKERNELRDLVGKNLHVLGQIEGVDLEMYKETVLPRVLEQVVNC 250 Arabidopsi...
EFJ27365          174 GSVNDAVEFVLQNFTEMNKLWVRMQhqgPAREKEKREKERRQLRDLVGKNLHVLSQLEGVDLAMYRDVVLPRVLEQVVNC 253 Selaginell...
XP_001418970      175 GNIDDAVEFLLQNFTEMNKLWVRMQhigPSNGKKRREGEREELRDLVGKNLLALSQLEGVDLQLYRETVLPRILEQVVNC 254 Ostreococc...
EEH58100          158 GSVADAVDFVLQNFTEMNKLWVRMQhggPARERERREKERRELRDLVGKNLLVLSQLEGMTLEMYRDVVLPRVLEQVVNC 237 Micromonas...
jgi:MICPUN_105123 173 GNVNDAVEFVLQNFTEMNKLWVRMQhggGNRDRERREKERRELRDLVGKNLLVLTQLEGMTLDLYKGTVLPRVLEQVINC 252 Micromonas...
6VAB_B            254 RDALAQEYLMECIIQVFPDEFHLQTLNPFLRACAELHQNVNVKNIIIALIDRLALFAHREDgPGIPA--EIKLFDIFSQQ 331
XP_003288783      257 KDKIAQEYLMEILIQVFPDEFHLATLDDILQTCAQLQSGVNVKAIIASLIDRLANFATRNA-ELVPS--DIKIFDIFFNN 333 Dictyostel...
XP_009121078      251 RDEIAQYYLMDCIIQVFPDEYHLQTLDVLLGACPQLQPSVDIMTVLSRLMERLSSYAALNT-EVLPYflQVEAFSKLNNA 329 field mustard
XP_002877795      247 KDELAQCYLMDCIIQVFPDDFHLQTLDVLLGACPQLQPSVDIKTVLSGLMERLSNYAASSV-EALPNflQVEAFSKLNYA 325 Arabidopsi...
XP_002466271      261 KDDLAQFYLMDCIIQVFPDEYHLQTLETLLSAFPQLQPSVDIKTVLSQLMDRLSNYAASSP-EVLPEflQVEAFAKFSSA 339 sorghum
EFH65306          251 KDKLAQYYLMECIIQVFPDEYHLQTLETLLAACTQLMPTVDTKIVLTQLMDRLSNYAASSP-DVLHEflQVEAFAKLSNA 329 Arabidopsi...
EFJ27365          254 KDEIAQYYLMDCIIQVFPDEFHLQTLESLLGACPQLQTTVDVKTVMAQLMDRLSNYVASTP-DVLPEilQVEAFGKLSTA 332 Selaginell...
XP_001418970      255 KDELAQPYLLDVLIQVFPDEYHLATFEEVFSTMSMLRANVRVGSILNALLGRLLSYAEETP-EAKSEfeAADVFPKSFEC 333 Ostreococc...
EEH58100          238 KDDIAQPYLMDAIVQVFPDEFHIQTLQLLLDACPKLKSTVKVGNVLASLMDRLTNAAKESQ-EMVTQfaAVDAFGKLATC 316 Micromonas...
jgi:MICPUN_105123 253 KDDIAQPYLLDALIQVFPDEFHVQTLDAFLEACPLLKPTVKIGNVLASLMERLASSARDNP-EIVAQfvAVEAFGKLSAG 331 Micromonas...
6VAB_B            332 VATVIqsrqdmPSEDVVSLQVSLINLAMKCYPDRVdYVDKVLETTVEIFNKLNLeh------------------------ 387
XP_003288783      334 VREIIkarpnmELQDILGLHVSLLNLTLKCYPTNKdNANEVLGLCQSIISTKSKed------------------------ 389 Dictyostel...
XP_009121078      330 IGKVIeaqedmPILSAVTLYSSLLKFTLHVHPDRLdYADQVLGSCIKQLSGKGKi------------------------- 384 field mustard
XP_002877795      326 IGKVVeaqvdlPAAASVTLYLFLLKFTLHVYSDRLdYVDEVLGSCVTQLSATGKl------------------------- 380 Arabidopsi...
XP_002466271      340 IGKVIeaqpdmPVVGAVTLYVSLLTFTLRVHPDRLdYVDQVLGACVKKLSGKAKl------------------------- 394 sorghum
EFH65306          330 IGKVIdtqlemPIVGAMTLFVSLLTFTLRVHPDRLdYVDQVLGACVVKLSSVPKl------------------------- 384 Arabidopsi...
EFJ27365          333 TMKVIdaqpdmPLVGAVSLFVALLTFTLRVHADRLdYVDQVLGACFKKLEGRGKv------------------------- 387 Selaginell...
XP_001418970      334 CQAIIgahddvPAKEIIGMYAALMAFARKLQITEAgTLDDILLALANSLQSKLPi------------------------- 388 Ostreococc...
EEH58100          317 VDDVVraqptlDAHERLLMHGALLSFTIATHRERLdHVDGVLASCAAAMGASSSngdddddagda-----------rdgp 385 Micromonas...
jgi:MICPUN_105123 332 CKSIIasqpsmDAHDRLQMHAALMGFVTAVHRDRLdYVDDVLGACADALNAPGGgdekdskenssdervdrggidggaed 411 Micromonas...
6VAB_B            388 -----iaTSSAVSKELTRLLKIPVDTYnnILTVLKLKHFHPLFEYFDYESRKSMSCYVLSNVLdy-nTEIVSQDQVDSIM 461
XP_003288783      390 ------iNKPTCVKQIIQLLQIPLDVFknVLVVLSLTNYQPLISCLSYNNRKKVSLDIVNSTIqn-sTIIEEPEAVSNLL 462 Dictyostel...
XP_009121078      385 -------HDTRATKELVTLLSAPLEKYndVVIALKLTNYPLVLDYLDSENKRVMATVIIRSIMkn-kTIIATAEKVEALL 456 field mustard
XP_002877795      381 -------CDDKAAKQIVAFLSAPLEKYnnVVTILKLTNYPRVMEYLDHETNKAMAIIIVQSVLkn-nTHIATADEVDALF 452 Arabidopsi...
XP_002466271      395 -------EDSRATKQIVALLSAPLEKYsnIVTALELSNYPRVMDYLDNATTKVMAVVIIQSIMkn-tTCISTSDKIESLF 466 sorghum
EFH65306          385 -------EDARAMKQVVALLSAPLEKYsdIVTALTLSNYPRVMDHLDDGTNKVMAMLIIQSIMkt-dSCISTADKVEVLF 456 Arabidopsi...
EFJ27365          388 -------KDSKATKQIVALLSAPLEKYndVVTVLKLTNYPRVMDHLDYETNKSMAVTIIQFIMkn-nTLISSVDKVEALF 459 Selaginell...
XP_001418970      389 -------TDPEVAQQLSTLLSDPLESCe-LSVVLSLKSYPKVIALLDEDTKKKVALGVVQTLVkn-rSTLTTVDHVKMLY 459 Ostreococc...
EEH58100          386 iapamivSDPKGIRQLVALLTTPLETYd-PISVLRMSSYPRVMTLLLPANLRQLAATIARAVLrg-eTRVSTPEQVETLF 463 Micromonas...
jgi:MICPUN_105123 412 agppmivSDQKGVRQLHALLTVPLDTYd-VVSVLGLSNYPRVMSLLQPANLRQMAMTIVKSVIrepeGAVSDATQAETLF 490 Micromonas...
6VAB_B            462 NLVSTLIQdqpd-qpvEDP-----DP-EDFADEQSLVGRFIHLLRS--DDpdqqylILNTARKHFgaGGNQRIRFTLPPL 532
XP_003288783      463 ETISTLIKde-----eDQPsmddiDK-EDFQEEQNKVASLIHLFDS--EDpeklfkIYIIARGHFgtGGQHRIRHTLVPL 534 Dictyostel...
XP_009121078      457 ELIKGLINdldep------qglevDE-DDFEEEQNSVARLIHMLYS--DDpeemfkIISVLKNHFltGGPKRLKFTIPPL 527 field mustard
XP_002877795      453 ELAKGLIKdfdgk------vdyeiDE-EDFQEEQNLVARLVHKLYS--DDpeemskIIFTVRKHIlaGGPKRLPLTIPPL 523 Arabidopsi...
XP_002466271      467 DLIKGLIKdmdga------qddelDE-EDFKEEQNSVARLIHMLHN--DDpeemlkILCTVQKHIlqGGPKRLTFTVPSL 537 sorghum
EFH65306          457 ELIKGLIKdldet------naeelDE-EDFQEEQNSVARLIHMLDN--EEpeemlkIICVVRRHLmtGGPRRLPFTVPPL 527 Arabidopsi...
EFJ27365          460 ELLKELIKdseg--------npalDEaKDFQEEQNLVAKLVHLLKN--DDdtemfkILEAATKHFteGGSKRLSLTLPSL 529 Selaginell...
XP_001418970      460 DFIDCVVSadakeasqAMEdvekeRS-AAIAEEQNVVARVVHLIKApeDNhelqleMLNTAYDILlkGGPRRIRHTFPAL 538 Ostreococc...
EEH58100          464 KFIEVLIRd-------GDDggggvDE-EDFEEEQGLVARLVHVLRS--DShetqyeLLVAARKQFqsGGAKRLRRTLPPL 533 Micromonas...
jgi:MICPUN_105123 491 RFISVLIKdregv-------aeevDE-EDFEEEQNAVARLVHALQS--GDsdtqyrLLVASRKHFgqGGPRRLKHTLPPL 560 Micromonas...
6VAB_B            533 VFAAYQLAFRY----KENSQMDdkw------------ekKCQKIFSFAHQ--TISALI-KAEl-aELPLRLFLQGALAAG 592
XP_003288783      535 VFCSLRFIRNFkqqvdtgvi----------tldqnkwntIGGKIYTFVSE--TIKALAdIKLa--DLSFRLYLQALQTFD 600 Dictyostel...
XP_009121078      528 VVSALKLIRRLpeegDNPFGKEas--------------vSATKIFQFLNQ--IIEALPsAPSp--DLAFRLYLQCAEAAN 589 field mustard
XP_002877795      524 VFSALKLIRRLrggdENPFGDDas--------------aTPKRILQLLSEasTVEVLSdVSAp--DLALRLYLQCAQAAN 587 Arabidopsi...
XP_002466271      538 VFSALKLVRRLqgqdGDVTGEDvp--------------aTPKKIFQILHQ--TIEALScVPSp--ELALRLYLQCAEAAN 599 sorghum
EFH65306          528 VFSAVRLVRQLesqgGDIAGEDvp--------------aTPRKIFQILNQ--TIEVLSsVPCp--ELALRLYLQCAEAAS 589 Arabidopsi...
EFJ27365          530 VFSALKFVRQLqfrnAT---DEsp--------------vSPKKVFQYLHQ--TIESLStVPAp--ELALRLYLQCAEAAS 588 Selaginell...
XP_001418970      539 VFAGIACGRDIvpadANNDDKEaisfttp----ievkspWLKKSLHFVHK--SITALTeVAGr-hEKALKLFLEAAQLAA 611 Ostreococc...
EEH58100          534 AFEATRLGRAIlrdaAADASAAppaa---------aaaaLVAKTLQFLHQ--TIAALAeTPAp--EPALRLFVDAARLAD 600 Micromonas...
jgi:MICPUN_105123 561 AHEAMRLGRSLlaraRADSGSGdsgaaaaaaaatgpmgpALKKILQFLHQ--TISALAaAPVsrhEPAMRLFLEAAQLAD 638 Micromonas...
6VAB_B            593 EigfENhetVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTFERMKCF---SEENHEPLRTQCALAASKLLKKPDQGRA 669
XP_003288783      601 QcglVG---KVKELAIKALLIFQEDIADFKSQVSALQLLIATLNS---LnipDEEIYESLAAQTIKQASRLLLAPDQAKL 674 Dictyostel...
XP_009121078      590 KcdeEP---IAYEFFTQAYILYEEEISDSKAQVTALQLIIGTLQRMHVF---GVENRDTLTHKATGYSAKLLKKPDQCRA 663 field mustard
XP_002877795      588 DcelET---VTYEFFTKAYLLYEEEISDSKAQVTALRLIIGTLQRMRVF---NVENRDTLTHKATGYSARLLRKPDQCRA 661 Arabidopsi...
XP_002466271      600 DcdlEP---VAYEFFTQAFILYEEEIADSKAQITAIHLIIGTLQRMNIF---GVENRDTLTHKTTGYSAKLLKKPDQCRA 673 sorghum
EFH65306          590 DcdlEP---VAYEFFTQAFILYEEEIADSKEQVTAIHLIVGTLQRINVF---GIENRDTLTHKATGYSARLLKKPDQCRA 663 Arabidopsi...
EFJ27365          589 DcdlEP---VAYEFFTQAFMLYEEEIADSKAQITAMHLIIGTLQRTTVF---GVENRDTLTHKATGYSAKLLRKPDQCRA 662 Selaginell...
XP_001418970      612 VanlES---IAYEFFERAFVLYEENITDTKKQVNLLFIIIGTLHKVNVF---GADSRESLVHKTTGYSARLLKKPDQCVG 685 Ostreococc...
EEH58100          601 AagmET---LAYDFFESAMTIYEDDISDSRAQKSALSIMVGALQPCRSF---TAESRETLSHKSIGYASRLLKKPDQCAA 674 Micromonas...
jgi:MICPUN_105123 639 AsgmEP---VAYEFFERAMTIYEDEISDSAAQRSALSCVVGALHSCVGF---TAESRESLVHKTTAYSARLLKKPDQVRA 712 Micromonas...
6VAB_B            670 VSTCAHLFWsgrntdkngeELHGGKRVMECLKKALKIANQCMD---------PSLQVQLFIEILNRYIYFYe---kENDA 737
XP_003288783      675 IATCSHLFWvdh----pdrQYQNPESVLQALKKALSIISNETN-----------PGLSVFVDILNECLFYCd---kNTGA 736 Dictyostel...
XP_009121078      664 VYACSHLFWlqd-----qeTIQDGERVLRCLKRALKIANSAQQmtsa--argSTGSVTLFIEILNKYLYFYe---kGIPQ 733 field mustard
XP_002877795      662 VYECSHLFWade-----ceNLKDGERVVLCLKRAQRIADAVQQmanasrgtsSTGSVALYVELLNKYLYFLe---kGNPQ 733 Arabidopsi...
XP_002466271      674 VYACSHLFWtdd-----qdGIMDGERVLLCLKRALRIANAAQQmasa--trgSSGSVTLFIEILNKYLYFFe---kGIPQ 743 sorghum
EFH65306          664 VYACSHLFWvdd-----pdGIKDGERVLLCLRRALRIANAAQQmasa--trgSSGPVTLFVEILNKYIYFFe---kGNPH 733 Arabidopsi...
EFJ27365          663 VYACSHLFWnd------dgGTQDGERVLLCLKRALRIANAAQQvssa--srgSSGPVTLFVEILNKYLYYFe---kGVPA 731 Selaginell...
XP_001418970      686 AYTCAHLFWt--------eTVKDSDSVASCLKKSVKIANAVRDtfgg-naanRIEALGLYVGILNKYLYFYdktpeGCTS 756 Ostreococc...
EEH58100          675 VASCAHLFWs--------dAVKDGKGVLSCLKKALTIASKARVaasa-tgkgAGDALALHIAVLNKHLYFFe---rGVDG 742 Micromonas...
jgi:MICPUN_105123 713 VSDCAHLFWgpdg---vdgAARDATSTVTCLKKALKIAGGVQQaslggvgggGGDALRLFIEVLNKYLYFFe---rGCPG 786 Micromonas...
6VAB_B            738 VTIQVLNQLIQKIRE 752
XP_003288783      737 VPVQFISDLVELIRT 751 Dictyostelium purpureum
XP_009121078      734 VTVESVESMIQLIKN 748 field mustard
XP_002877795      734 VTGDTIQSLAELIRS 748 Arabidopsis lyrata subsp. lyrata
XP_002466271      744 ITNTVIQDLIELIRT 758 sorghum
EFH65306          734 ITPSDIQSLIELINN 748 Arabidopsis lyrata subsp. lyrata
EFJ27365          732 VASSLVQGLLELIMT 746 Selaginella moellendorffii
XP_001418970      757 VTVEALQALIDMINT 771 Ostreococcus lucimarinus CCE9901
EEH58100          743 VDAKVIRELLEHING 757 Micromonas pusilla CCMP1545
jgi:MICPUN_105123 787 VDASILQGLLEIING 801 Micromonas commoda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap