6EBY,5JA2


Conserved Protein Domain Family
MbtH

?
pfam03621: MbtH 
Click on image for an interactive view with Cn3D
MbtH-like protein
This domain is found in the MbtH protein as well as at the N-terminus of the antibiotic synthesis protein NIKP1. MbtH and its homologs were first noted in gene clusters involved in non-ribosomal peptides and other secondary metabolites by Quadri et al. This domain is about 70 amino acids long and contains 3 fully conserved tryptophan residues. The structure of the PA2412 protein shows it adopts a beta-beta-beta-alpha-alpha topology with the short C-terminal helix forming the tip of an overall arrowhead shape. MbtH proteins have been shown to be required for the synthesis of antibiotics, siderophores and glycopeptidolipids.
Statistics
?
PSSM-Id: 397605
Aligned: 154 rows
Threshold Bit Score: 67.5386
Threshold Setting Gi: 81420003
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6EBY_A         9 TNPFDDDEGVFLVLVNDEDQYSLWPEFAEVPQGWRTVFGPTSRAAALDYIN 59  Thermobifida fusca YX
Q87WM5         1 mtDEEKNQGDYLVVANAEEQYSIWAADLPLPGGWQFMGKRASKSECLEYIK 51  Pseudomonas syringae pv. tomato
Q217L8         1 mrQDEDDNRQYAAVKNPEEQYSIWPIDQPVPAGWTAAGCTGSKQHCLSFIK 51  Rhodopseudomonas palustris BisB18
jgi:Nhal_1785  1 -mSIDHEDTQFEVVVNDQDQYSIWPTYHPIPEGWQSVGVKGNRQTCLQYIS 50  Nitrosococcus halophilus Nc 4
Q0VMQ6         1 -mSIDNPETEFTVVINDQEQYSIWPTYRPVPAGWKTVGVTGNKTECLEHIN 50  Alcanivorax borkumensis SK2
EIC30046       1 -mSIDSEDAIFQVVVNDEEQYSIWPDYKAVPGGWRTVGKSGVKKDCLAYIE 50  Methylomicrobium album BG8
5JA2_B         4 TSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIE 54  Pseudomonas aeruginosa PAO1
WP_013660132   1 -mSLDDPNTIFNVVMNDEEQYSIWPEYKEIPNGWREAGKKGNKEECLSWVQ 50  Marinomonas mediterranea
jgi:Pmen_2864  1 -mSFDNENARFLVVINHEQQYSIWPEYKAIPEGWSAVGVSGDKAACLAHIE 50  Pseudomonas mendocina ymp
WP_013234317   1 -mSFDADDAVFRVLVNHEEQYSIWPDYKAIPPGWTDVGVSGDKATCLAHVE 50  Herbaspirillum seropedicae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap