1ODH


Conserved Protein Domain Family
GCM

?
pfam03615: GCM 
Click on image for an interactive view with Cn3D
GCM motif protein
Statistics
?
PSSM-Id: 397602
Aligned: 14 rows
Threshold Bit Score: 263.851
Threshold Setting Gi: 156212142
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ODH_A               30 TDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQ 109 house mouse
Q17NS1               37 LDEFNEWSDGHCRYIYRSMDEMAKRHSSGWAMRNTNNHNVSILKKSCLGVLVCSARCALPNGDKIHLRPAICDKARRKQQ 116 yellow f...
FlyBase:CG12245-PB   47 FDDFNDWSNGHCRLIYSVQSDEARKHASGWAMRNTNNHNVNILKKSCLGVLLCSAKCKLPNGASVHLRPAICDKARRKQQ 126 fruit fly
EFA04430             26 FDSFSEWADGHCRLVYRADNEDAKRHSSGWAMRNTNNHNVHILKKSCLGVLVCSLRCTLANGERVHLRPAICDKARKKQQ 105 red flou...
CDS43398            176 YDPYDLWPDGNCRRIYSMASERARRHQSGWAMRNTNNHNPQVLKKSCLGVLVCSLGCISPNGLPVAYRPAICDKARKKQC 255 Echinoco...
EDO33215             11 FDEFNEWIDGSCKLRYSAYSREAQAHISGWAMKYTNNHNKYVLKKTCVGVLLCSKDCTLPNGLKIVVRPAISDKVRERQI 90  starlet ...
Q5TLZ9               19 YDAFQEWTDGYVRYIYSSEDKNAQRHLSGWAMRNTNNHNCQILKKSCLGVVVCSRNCSLPDGSKLQLRPAICDKARQKQQ 98  zebrafish
WGS:AAPP:GF22779-PA  83 FDEFNEWSDGHVRHIYSLHNEEAKKHISGWAMRNTNNHNVNILKKSCLGVLVCSQHCTLPNGSKINLRPAICDKARRKQE 162 Drosophi...
XP_006010669         38 TDWFQEWPDSYMKCIYSIGDKNAQKHLSGWAMRNTNNHNSRILKKSCLGVVVCSQDCTTPDGKKIHLRPAICDKARQKQQ 117 coelacanth
XP_015218200         36 TDVFQEWTDSYVKLVYSSEEKNAQRHLSGWAMKNTNNHNSRILKKSCLGVVVCSNNCTTADSREIHLRPAICDKARQKQQ 115 spotted gar
1ODH_A              110 RKSCPN--CNGP-LKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARR 167 house mouse
Q17NS1              117 GKSCPNrlCVGGiLEIQPCRGHCGYPVTHFWRHTPNAIFFQAKGVHDHPRPESKSSGETRK 177 yellow fever mosquito
FlyBase:CG12245-PB  127 GKQCPNrnCNGR-LEIQACRGHCGYPVTHFWRRDGNGIYFQAKGTHDHPRPEAKGSTEARR 186 fruit fly
EFA04430            106 GKPCPNrqCTGR-LEILPCRGHCGYPVTHFWRHTDHAIFFQAKGVHDHPRPEAKSTSEARR 165 red flour beetle
CDS43398            256 MRSCTTpgCKGR-LVQKNCKGHGGYPVTHFWRFCNGAVFFQAKGRHDHVKPTTKALSsgaa 315 Echinococcus multilocularis
EDO33215             91 GQNCPNasCSGI-LSHRKCTGNNGYPVTHFWVHQDDGIYFESKGTHDHFRPQARRATPdrg 150 starlet sea anemone
Q5TLZ9               99 KKLCPN--CNSA-LELIPCRGHSGYPVTNFWRVDGKAIFFQAKGVHDHPRPESKSETEARR 156 zebrafish
WGS:AAPP:GF22779-PA 163 GKACPNksCRGGrLEIKPCRGHCGYPVTHFWRHSGNAIFFQAKGVHDHLRPDPKNSSVSKR 223 Drosophila ananassae
XP_006010669        118 KKRCPN--CGAS-LTLVFCQGHGGYPVTNFWRHEGPYIYFQSKGVHDHPRPETKVEAEVRR 175 coelacanth
XP_015218200        116 KKECPN--CNAP-LRLLCCKGNGGYPVTNFWRQEGPYIFFQSKGQHDHPKPESKLEAEARK 173 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap