Conserved Protein Domain Family
EIIBC-GUT_N

?
pfam03612: EIIBC-GUT_N 
Sorbitol phosphotransferase enzyme II N-terminus
Statistics
?
PSSM-Id: 397600
Aligned: 52 rows
Threshold Bit Score: 222.034
Threshold Setting Gi: 81522011
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
lgeUNICAMP:PACID_21770  10 SVTVSKGSGGYGGPLTLTPTPEKDK-LVYIVgGGMRPPVVDRIAELTGAEPVNGFNTSVPDDQMMAVIIDCGGTLRCGIY 88  Acidi...
WP_012862753             4 ILKVSRGSNGWGGPLYLKNEPEKK--IVSMT-GNFIDPVAEKIAEMLGLEVVNGFKHTPQDTEILCVIINCGGTLRCGIY 80  Sebal...
WP_015069569             8 AVRIDHGSGGWGLGLVVRAHGERNI-VLSVT-GGDEHPVAKKIAELTGGRVVNAFNAGAPDNQVLCAVINCGGTARSGVY 85  Acidi...
WP_012009881             5 KVFVAKGAGGWGQGLELEPTGKRRK-VVSIT-GGGIHPVARKIAEMTGTEACDGFKNSIPEDEMMCVVIDCGGTARIGLY 82  Bacil...
Q8Y9I5                   4 SIHVNKGQGGWGVGLDITPSEPRTK-VVSIT-GGGIHPVALRIAELSGAEAVDGFKNSIPEEEMMCVVIDCGGTARIGVY 81  Liste...
WP_015510127             4 KIFVKKGSNGWGKGLEIEPEGKKIK-IISVT-GGGIHPVAKKMGELSGAEVVDGFSNAISEEEIMAAVIDCGGTARIGVY 81  Enter...
EOU08009                 5 KLIIHKGNGGWGGPLTIPLNDERKKyVISVT-GGGIHPVAEKIAELAGVTAVDAFKNPVEKEETLCAVIDCGGTARCGTY 83  Enter...
Q9KES7                   5 AVKITKGSGGWGGPLVVLPAGEKKY-IVSVT-GGGIHPVAQRIAELTGAEAVDGFKSSYEKETMACVVIDCGGTARCGVY 82  Bacil...
WP_009291051             4 AVTITKGSSGWGGPLTVCETETRKV-VASVT-GGSIHPLAEKIADLLGVPVVDAFNNKVEPDTIIIAVVDCGGTLRCGVY 81  Anaer...
WP_005228107             4 TVIVKHGTKGWGGPLTLEPTTEKTV-VASIT-GGGIHPVAKKIAEQLGVEAIDGFKEKVEPSQMICAVVDCGGTARCGVY 81  Enter...
lgeUNICAMP:PACID_21770  89 PRKGIPTINVMPTGKTGPLAQYINESIYVSAVDVDQVALAgdaamtaptaqpvqaaPAAQGDSAESGTRAGTAGTVQ--- 165 Acidi...
WP_012862753            81 PKKRVPTINVTPVGKSGPLAEFILEDIYVSDVREGNLELV-------------------SGMKENGTAEKRTKDSIE--- 138 Sebal...
WP_015069569            86 PKKRIPTVNVFNASPGGPLQKYITDDIYVSGVGVDNVQPA----------------DPAEVAIGDDSAESAAPAPAApa- 148 Acidi...
WP_012009881            83 PMKRIPTVDVLASSPSGPLAKHITEDIFVSGVTEKDISFA---------------------------DASSGEAKVEgqd 135 Bacil...
Q8Y9I5                  82 PMKRIPTVDVLPSSPSGPLAKHITEDIFVSGVKPEDIEVR-----------------------------------DIsae 126 Liste...
WP_015510127            82 PMKKIPTVDVLPSSPSGPLAKFITEDVFVSGVTPEDIELC----------------ENKGAVPVEEKTLEKQADTETada 145 Enter...
EOU08009                84 PRMKIPTINVKLQAPSGPLAKFMTEDIFVSGTTITNIEII-------------------SESEAAQVHNKEDKNEKTsni 144 Enter...
Q9KES7                  83 PKMGVLTVNINATSPSGPLMKFINEQNFVSGVTESDIQLT----------------DGEAAAAIEPQEEKKLSAQE---- 142 Bacil...
WP_009291051            82 PKMGVKTIDIHPISPSGPLSKYIKEDNFVSGCTLDCISL-----------------NGEAVSLENEEAEKPAS------- 137 Anaer...
WP_005228107            82 PKLNVLTVNLHPTTPSGPLMKFINEKNFVSGVTIDDVYSS----------------DEAMTESSVTSEKVKEPTPTK--- 142 Enter...
lgeUNICAMP:PACID_21770 166 ----------GQWSTDKKISETVAQKKNKTLMEKIGLGAGHVIAAFYQAARDAVQ 210 Acidipropionibacterium acidipr...
WP_012862753           139 ----------DAVVKKMESMERTEKFSFLRLIEKIGLNIGNVVTLFFQSGKEAVD 183 Sebaldella termitidis
WP_015069569           149 --------paAQDAAQQPSRQTKEASGFSKFIIKFGGAIGYVITSLLNAGREGVk 195 Acidipropionibacterium acidipr...
WP_012009881           136 nsepidkenfKETYSKLKEENLERQEKG-NFLMRFSRGIGKVTGTFYQAGRDSVD 189 Bacillus pumilus
Q8Y9I5                 127 pgkpfdrekfKEDYAKIKEDQKEASELKEGFLVKFSRGIGKAMGVFYQAGRDSVD 181 Listeria monocytogenes
WP_015510127           146 p------esfEEKYAQAKAQHQAQNAQKESILVKFSRGIGKVMGIFYQAGRDAVD 194 Enterococcus casseliflavus
EOU08009               145 ntnkpettteITKETTEKKNHSNKKGGIFGLIDTIGRGAGSFINIMYQAGRETID 199 Enterococcus hirae ATCC 9790
Q9KES7                 143 ----------LKEEAKKKAAQYTGKEKKPNIIEKVGRGAGKVVGVFYQAGRETVE 187 Bacillus halodurans
WP_009291051           138 ----------EIPVPQAPEPSGPEGNKFFSFITGMGRGIGSIVNVFYQAGRDTLD 182 Anaerostipes
WP_005228107           143 ----------KEQVTAAKEKVAESQGGLLGFINRLGRSVGNIVGIFYQAGRDTIE 187 Enterococcus casseliflavus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap