6K1H


Conserved Protein Domain Family
EII-Sor

?
pfam03609: EII-Sor 
Click on image for an interactive view with Cn3D
PTS system sorbose-specific iic component
Statistics
?
PSSM-Id: 397597
Aligned: 223 rows
Threshold Bit Score: 141.009
Threshold Setting Gi: 530821575
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6K1H_B           7 QIVLVFIVACIAgmgs-----ildeFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIALGWMNIGAAVAPDAALASIIS 81  Escherichia c...
CDA34359         5 QAILIGIMSCTAastiaclgttvgnYTLNRPLVASLFVGLILGDVQGCILIGIPMQVMWIALVTPGGTVASDLRAVSYIG 84  Firmicutes ba...
WP_055182985     7 QAVILGIFACLAsmpgmg-gsaignYTLGRPLVAGLVCGIILGNVPAGIMVGAAMQVVYIALVTPGGTVSADVRAVSYIG 85  Anaerobutyric...
WP_012657738     7 QAVLLGIFASLAsmpgmg-gssignYTLGRPLVGGLVCGLILGDLKLGIVCGVAMQLVYIALVTPGGTVSADVRAVSYIG 85  Streptococcus
Q833U6           7 QAAILGLFACLCsnscma-gqavgnYTIGRPLVGGLVCGIILGDLKLGIACGVAMQLVYIALVTPGGTVSADVRAISYIG 85  Enterococcus ...
WP_022001604     7 QAALLGLFACLSsmpglg-gtsfgnYTLGRPLIGGLVCGIILGDIKTGILVGAAMQVVYIALVTPGGTVSADVRAVSYIG 85  Erysipelotric...
jgi:Sterm_3427   7 QAVLLGIFACLSsmpglg-gttignYTLGRPLVAGLVVGIILGDIKSGIIVGAAIQVIYIALVTPGGTVSADVRAISYIG 85  Sebaldella te...
jgi:Ethha_0816   7 QAALLGLFACLAslpgmg-gttignYTLGRPLVAGLIVGLIMGDVTTGVIVGAAIQIVYIALVTPGGTVSADVRAVSYIG 85  Ethanoligenen...
Q97J27           7 QAAIFGLFACLSsmpgmg-gttfgnYTLGRPLVAGLLVGIVLGDVQTGIIVGAAIQVVYIALVTPGGTVSADVRAVSYIG 85  Clostridium a...
jgi:Olsu_0648    7 QAALLGLFACLAslpgmg-gttvgnYTLGRPLVGGLVVGLILGDVPTGIIVGAAIQVVYIALVTPGGTVSADVRAVTYIG 85  Olsenella uli...
6K1H_B          82 TILVIAghq--------siGA--GIALAIPLAAAGQVLTIIVRTITVAFQHAADKAADNGNLTAIS----WIHVsSLFLQ 147 Escherichia c...
CDA34359        85 IPLAYVgakaagmdfggseAQglASSISAMTGVIGISLFYGTAMMNLIWQHYGWAQLKKGNLDCLG----KVDTiLPLIS 160 Firmicutes ba...
WP_055182985    86 IPLAMLalnsygldpastkGVamATSFGAMVGTLGTVLFYGTATINLVWQHIGWRAVEKGEFKKLY----LVDMvLPWIS 161 Anaerobutyric...
WP_012657738    86 IPLAMVaitaqgisvgsasAAdlAKSMGTLVGTVGTVLFYGTATLNLAWQHIGWKAVEEGNFKKLY----MVDWgLPWIS 161 Streptococcus
Q833U6          86 IPLAMVaistkgldplggsAAdlAKSVGTLVGTIGTVLFYSVAALNLVWQSFGWKDIKKGKLDHLY----AINFgWPWIS 161 Enterococcus ...
WP_022001604    86 IPLAMValnsyglsaatkeGAalATSFGTMVGTLGTVLFYGTATINLAWQHVGWKAVEKGDYHKLY----LVDMvLPWIS 161 Erysipelotric...
jgi:Sterm_3427  86 IPLAIVsikglgidpstteATqlAAALGAAVGTLGTVLFYGTATVNLLWQHIGWKSIEKGNFKNLY----FVNMvYPWIS 161 Sebaldella te...
jgi:Ethha_0816  86 IPLAIMaikglgispattqAQqlATSLGAAVGTVGTVLFYLTATINLVWQHIGWKAIEEGNLHRVY----LVNKgLPWIS 161 Ethanoligenen...
Q97J27          86 IPLAVVaikgmglnpssaqATqmATALGAAVGTLGTVLFYGTATINLIWQHIGWKSIEKGDFKKLY----LVNMgLPWVS 161 Clostridium a...
jgi:Olsu_0648   86 IPLSILaihaqgldpssteAAslAAALGAAVGTIGTVLFYGTATLNLVWQSIGWKAMETHDWKRIRrtipLVDFvYPWVS 165 Olsenella uli...
6K1H_B         148 AMRVAIPAVIVALSVGTSEVQNMLNAIPEV--VTNGLNIAGGMIVVVGYAMVINMMRAGYL-MPFFYLGFVTAAFTNFNL 224 Escherichia c...
CDA34359       161 HFVLSFLPVTLLCYYGSGAVQELFKNLNTDvwYIKAILSVGSVLPAVGIGILLKSVVTKTSdLVFFAFGFTIAASMNLTL 240 Firmicutes ba...
WP_055182985   162 HLICSFIPTVVMCKLGVPVVETIKATLPMDglAMKTLFTVGSMLPCVGIAILLKQVVNKVTdFVPFFVGFTLAAGVGLNL 241 Anaerobutyric...
WP_012657738   162 HFVFSFLPTLIMCKLGASAVTALQSALPMDgiAMKTLFTVGALLPCVGIAILLKQLVEKVTdFIPFFVGFTLAASLGLNL 241 Streptococcus
Q833U6         162 HLLFSFLPTVILTYFGATAVTAMRDALPMDglAMKTLFTVGGMLPCVGIAILLRQIVNKNIdFVPFFVGFTLAASLKLNL 241 Enterococcus ...
WP_022001604   162 HILCSFIPALIMCKLGADVVELIKTTLPMDglAMKTLFTVGSLLPCVGIAILLKQIVTKAVdFIPFFFGFTLAASMGINL 241 Erysipelotric...
jgi:Sterm_3427 162 HIICSFIPTFIITISGEYMVQIIKNYLPMDgiAMKTLFTVGSLLPAVGIAILLKQVVTKPTdLITFFFGFTLAASMGVNL 241 Sebaldella te...
jgi:Ethha_0816 162 HIICSFIPAFAINLVGSSMVSAIKTYLPMDgiAMKTLFTLGSLLPAVGIAILLKQVITKPVhFLSFFFGFTLCAIMGLNL 241 Ethanoligenen...
Q97J27         162 HIICSFIPAFIITRMGSSMVKIMKVALPMNgiPMKTLFTVGSLLPAVGIAILLKQVVLKPSdFITFFLGFTLAAVMKVNL 241 Clostridium a...
jgi:Olsu_0648  166 HILFSFVPTFIICMAGSSMVQLMKDYMPMDgiAMKTLFTVGSLLPAVGIAILCKQVVNKPLdWLTFAFGFTLAACLHMNL 245 Olsenella uli...
6K1H_B         225 VALGVIGTVMAVL 237 Escherichia coli str. K-12 substr. MG1655
CDA34359       241 IAATVVGGVFALI 253 Firmicutes bacterium CAG:536
WP_055182985   242 VSVTVVAGMFAII 254 Anaerobutyricum hallii
WP_012657738   242 VASAVISLIFALL 254 Streptococcus
Q833U6         242 VSITIIALLFAVI 254 Enterococcus faecalis
WP_022001604   242 VAATVIAGMFALI 254 Erysipelotrichaceae
jgi:Sterm_3427 242 IGAAIVGGFFAIL 254 Sebaldella termitidis ATCC 33386
jgi:Ethha_0816 242 VSAALVAGFFAVI 254 Ethanoligenens harbinense YUAN-3
Q97J27         242 IGAAIIGIFFAII 254 Clostridium acetobutylicum
jgi:Olsu_0648  246 IACAIVAAFFALI 258 Olsenella uli DSM 7084
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap