Conserved Protein Domain Family
EII-GUT

?
pfam03608: EII-GUT 
PTS system enzyme II sorbitol-specific factor
Statistics
?
PSSM-Id: 397596
Aligned: 40 rows
Threshold Bit Score: 208.964
Threshold Setting Gi: 496593825
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013378526            4 LQTFGQGFMGLFQNGANYFIQLyVLQLLPWVIIMITFMHILFKLIGLERIEKLVKLCNKFFLTRWILSPVIAMVFSGNPM 83  Clostr...
Prjna32935:ECBG_02524   4 ITKFAESFMSLFQTGAETFISW-MTGIVPVVLMLMVAMNTLIAFLGEERVTKVARLSSKNPFTRYLLLPFLSAFMLGNPM 82  Entero...
WP_013668738            4 IVKFAEGFMNLFQTGADNFIAW-MGSIVPLVLMLMVAMNAVINLLGEERVTSLARVASKNVFTRYMILPFVSAFMLGNPM 82  Aeroco...
jcvi:HMPREF9154_2327   15 mVLAAEWFVGLFRKGAETFLNW-MTNIVPLVLMLLIAMNSLIALIGEERINKLAAKAGRNVISRYLILPWIGAFFLTNPA 93  Pseudo...
Q6A7N4                  4 LVKAAEWFVGLFQEGAKTFVSW-MGSIVPLVLMLLIAMNSLIRLIGEDRINRLAQKAGNNPVSRYLLLPFIGSFMLCNPM 82  Cutiba...
WP_009289144           23 LVTAAKGLTGFFRAAGTTFIDN-MYSILPMALIALTVLNAIVSLVGEDRFDKFAQKLTGNFFTRYTVLPYLGNFFVSSPI 101 Anaero...
wugsc:KPN_02951         3 LVSLAEGFIHLFQAAGKIFLDM-MTGLIPMLICLLLAINFLMKLVGTVRMEKVAALLGRSRILTYGVLPVLGWFFMSSPG 81  Klebsi...
jgi:Sterm_3333          4 ITNFAQSFIALFQEAGLTLVGM-VKGSVPMLIVLLTTINFIIKIIGEDKINNVARIFGKSKILTYGILPSFAWFFFSSPG 82  Sebald...
AJD54738                9 ITKFAEGFMKLFQAGGDNFVGW-MTSIVPVVLMLLVAMNALIALLGEEKVNKLARISAKNPLSRYMILPFISAFMLGNPM 87  Strept...
WP_003641598            4 VTDLASGFMGLFQSGGKTLIGW-MTSIIPVVLLLLVLMNAIIAFVGDKKMAKLARASSKNPVTRYLILPFVSAFMLGNPM 82  Lactob...
WP_013378526           84 TYPYARFLPENQKVAFFDPGI-SFCHPVTGLFPHANPGELFVWLGIASGVYVQgLqfgigiESLGGLAVEYFLLGMVMVL 162 Clostr...
Prjna32935:ECBG_02524  83 SFTMARFLPEYYKPSYYASQA-QFCHTSNGVFPHINPGELFVWLGIAQGITTL-G------LNSMELAIRYLLVGMIMNF 154 Entero...
WP_013668738           83 SMTMGRFLPEFYKPGYIAAQM-QFCHTSNGVFPHINPGELFVWLGVAQGIEAL-G------LNQMELAIRYLLVGLVMNF 154 Aeroco...
jcvi:HMPREF9154_2327   94 AFTLGRFLPEAYKPGYYASVA-QMVHTNNGLFPHNNPGELFVWAGIAQGIVTL-Q------LPTGDLAIRYLLLGAVLNF 165 Pseudo...
Q6A7N4                 83 VHSLGRFLPERYKPSYFASAA-QFCHTSNGIFPHINPAELFIWLGIAQGITKA-G------LPTGPLAIRYLLVGLVLNF 154 Cutiba...
WP_009289144          102 VFTFGRYLKEKYKAAFFEVANrTNMAPMMCLFPHVNPAEMYVWLGVYEGVVKMyGt-----QAGGLLAVCTFLVGMCTSS 176 Anaero...
wugsc:KPN_02951        82 ALTLGKLLPEKSKPGYEDALG-TTAHPLTSLFPHVVPSELFVWLGVAAGVKEL-G------LPVTSLALRYIAAAMLIGL 153 Klebsi...
jgi:Sterm_3333         83 ALTVGRFLPEKCKPGYQDALG-ATAHPLTALFPHVVPSELFIWLGVAEGIKKI-G------LPVSGLAIRYIIAGVIVGL 154 Sebald...
AJD54738               88 AISMGRFMPEYYKPSYIASQM-QFCHTSNGVFPHINPGELFVWMGIASGIKTL-G------LSQMDLAIRYLLVGLLMNF 159 Strept...
WP_003641598           83 AHSMGRFLPEYYKPSWYASIA-QFCHTSNGVFPHINPSEYFIWLGIAQGVQKL-G------LNTMDLAIRYLLVGLVMNF 154 Lactob...
WP_013378526          163 LRSIFTQVIYN 173 Clostridiales
Prjna32935:ECBG_02524 155 IGGWVTDFTTA 165 Enterococcus casseliflavus EC20
WP_013668738          155 VGGWVTDFITA 165 Aerococcus urinae
jcvi:HMPREF9154_2327  166 FGGWVTDFTTA 176 Pseudopropionibacterium propionicum F0230a
Q6A7N4                155 VGGWVTDLTTR 165 Cutibacterium acnes
WP_009289144          177 LIGLTIETVNG 187 Anaerostipes
wugsc:KPN_02951       154 IRGIITEYLFL 164 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
jgi:Sterm_3333        155 MRGFITEIIFV 165 Sebaldella termitidis ATCC 33386
AJD54738              160 VSGWVTDFTTA 170 Streptococcus mutans UA159-FR
WP_003641598          155 IGGWITDFTTA 165 Lactobacillus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap