Conserved Protein Domain Family
CitMHS

?
pfam03600: CitMHS 
Citrate transporter
Statistics
?
PSSM-Id: 397589
Aligned: 564 rows
Threshold Bit Score: 33.3922
Threshold Setting Gi: 504635821
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFN59045             80 FILMVFDV---VGADLVMNmvlalmvifkiitiksalvgYGNSGL---------------------------------MT 123  Chlorel...
WP_011737737         44 YILVMVEEfthFRKSKPVI--------------------LVAGIIwgligwvyssqglphs-aevalrhnileyselfLF 102  Candida...
Q2SNX0               47 YIAVMAEEvlhLRKSKPVI--------------------FAAGLIwvlvasvaqdmgrsddeihnavshnlleygalfLF 106  Hahella...
Q606F9               62 YAFVMTEEfthLRKSKPVI--------------------LAAGIIwaqvaymastagvaaeevhrafehdlkeyaelmLF 121  Methylo...
CDK99780             45 YMLVIAEEtthLRKSKPVV--------------------VAAGILwvlialvyggmgrpde-vegplrhvfleyaellLF 103  Magneto...
Q7MGC9               59 YILVMLEEylkMRKSKPVL--------------------LAAGLIwiligfsyqshgqsev-akaalehnlleyaellLF 117  Vibrio ...
rhodo:RCAP_rcc00376  23 YALVVMEEtthMRKSKPVM--------------------LAAGLIwmligiayarhglsdl-ahekathiveeygelfLF 81   Rhodoba...
Q3IZ53               21 YILVVFEEathLRKSKPVM--------------------LAAGLIwlliglayaiagrgee-tyelsahiieeygelfLF 79   Rhodoba...
Q5NEB2               50 YLLVMTEDftkLNKSKPVI--------------------VAAGVIwilvaivgeslgadni-vhsnfnhimteygellLF 108  Francis...
EIC31280             90 YIIAMTEDlhqLSKAKPMV--------------------LGSVLIwfaifiyystsygtakeivpifqsnlmayaelfLF 149  Methylo...
EFN59045            124 VVTLFMVAQGITSTGGADFIITKLLgtpkdtmLAQVR-------MCLVTALFSSFVndtpV----FCIMLPIVLTWAAK- 191  Chlorel...
WP_011737737        103 LLVAMTYIEAMRERQIFEALKVWLV-------NKGLTfrqlfwlTGFLAFFISPIA----DnlttALIMGAVVLAVGVGn 171  Candida...
Q2SNX0              107 LLVAMTFINAMEERHVFESLRSYLV-------HKGMSyrklfwvTGWLAFFISPVA----DnlttALLMGAVIMAVGGRd 175  Hahella...
Q606F9              122 LLVAMTYINAMAERNVFEALRSWLV-------TRKFGyrklfwiTGVITFFLSSVA----DnltsALLVGAVVMAVGAKs 190  Methylo...
CDK99780            104 LLVAMTYVNALEERRVFDTLRAWLI-------RSGFSyrklfwlTGVLAFFISPVA----DnlttALVMCAVVLAVGKEs 172  Magneto...
Q7MGC9              118 LLVAMTYINAMEERRLFDALQAWMV-------SKGFDfrrlfwlTGFLSFFISPIA----DnlttALLMCAVVMKVSGDn 186  Vibrio ...
rhodo:RCAP_rcc00376  82 LLVAITYVNTLEERRVFDALRAKLI-------GMGLSyrklfwlTGIIAFFLSGIL----DnlttALVMGTVVVAVGRAa 150  Rhodoba...
Q3IZ53               80 LLVAITYVNTLEERRGFEVLRAKLV-------SMGLSyrslfllTGALSFFLSGIL----DnlttALVMGTVVMALGSHs 148  Rhodoba...
Q5NEB2              109 LLVAMAYINLMEDRNVFAKLKSSLL-------RAGFGylatfwlTGIIAFFLSAVA----DnlttALVMSTVVISIGKDn 177  Francis...
EIC31280            150 ITVSMTFLNAMTERGIFDSLRIVLA-------NKQYTyrqlfwiTGALAFLLSTVI----SslavGLLMGYIILEIGKGq 218  Methylo...
EFN59045            192 ARLSIRqLLIPLSYCCLLGGlNTTIGTS------------------------TNLVVtgafdsrvldpeseyyqeglkpi 247  Chlorel...
WP_011737737        172 PRFVSI-AFINIVVAANAGGaFSPFGDIttlmvwqkgivefsqffsllvpslINFVV----------------------- 227  Candida...
Q2SNX0              176 TRFVSL-AMVNVVVGANAGGaFSPFGDIttlmvwaskkvqfeeffalfipsvLNFVT----------------------- 231  Hahella...
Q606F9              191 PKFVSL-GFINLVIAANAGGaFSPFGDIttlmvwqagkaeffdffelfipsvMNFVV----------------------- 246  Methylo...
CDK99780            173 PRFVAI-SCVNIVVAANAGGaFSPFGDIttlmvwqkgmvpfgqffalflpsvVNYVI----------------------- 228  Magneto...
Q7MGC9              187 PKFVNL-ACINIVIAANAGGaFSPFGDIttlmvwqaghvnfsqfmplflpsaINYLL----------------------- 242  Vibrio ...
rhodo:RCAP_rcc00376 151 PKFVMI-GCISIVVAANAGGaFTPFGDIttlmvwqkgvieffeffdlflpslVNWLV----------------------- 206  Rhodoba...
Q3IZ53              149 PRFVTI-GCISIVVAANAGGaFTPFGDIttlmvwqkgrldffeffailipslVNWAV----------------------- 204  Rhodoba...
Q5NEB2              178 KKFITM-ACVNIVVAANAGGaFSPFGDIttlmvwqtgvikfteffaiflpslVNFLV----------------------- 233  Francis...
EIC31280            219 SKFVGL-AGLNAVVGANAGGtMSPLGGIstffvwqqnalqftefftltipciVNFLV----------------------- 274  Methylo...
EFN59045            248 elfgiapygIPNTFWGI----------------------------IYIVLAA---------------------------- 271  Chlorel...
WP_011737737        228 ---------PAAIMHFSiknevatvsqskvd-iklggiaivvlfiITIITAVsfhnflhlppamgmmtglsylmia---- 293  Candida...
Q2SNX0              232 ---------PALIMNFFlpngvpsghgglvp-ikrgglricalflLTIATAVcferffhlppflgmmtgmsvlmff---- 297  Hahella...
Q606F9              247 ---------PAAFMHFAipnelpdfpeeevvvmkpgallicglfvLTISIAVsfkqflhlppflgmmvglsilmfy---- 313  Methylo...
CDK99780            229 ---------PAGLMHAAvpagtpaavdesva-mktgarrvmvlfaLTIATAVgfhnflhlppvigmmtglgylqlfg--- 295  Magneto...
Q7MGC9              243 ---------PALIMSFFipeerpqtvhvdve-lkrgarrivglfiLTIATAVafhavlhfppvigmmmglaylqffgyfl 312  Vibrio ...
rhodo:RCAP_rcc00376 207 ---------PAAIMSFAipnempartednar-mkpggamvivlfgLTIGSAIsfknflhlppamgmmlglgylqiys--- 273  Rhodoba...
Q3IZ53              205 ---------PAAILFFAvpkgtpdaqaetir-akpgalgvailfaATIVTAVsfknflnlppalgmmlglgylqlws--- 271  Rhodoba...
Q5NEB2              234 ---------PAIIMSFFipkmetqsiieekvelkrgaipvivlfiLTIATAVafehtlhlppslgmmtgfgyvmiynyfy 304  Francis...
EIC31280            275 ---------PAFIMQFSvtketpnfskekpv-lkrgskriififiLTFSTAIlsnvfldmpaiigmmfglamlqffayyl 344  Methylo...
EFN59045            272 ----------------------------------------PfLLtGgagmkvykrmgralsrkaqgglveesgadfffgv 311  Chlorel...
WP_011737737        294 -----------------ayfirkserklqqdgfdvfkkvaN-AE-W---------------------------------- 320  Candida...
Q2SNX0              298 -----------------ayflrktgtveddiqfdifrrvaR-AE-W---------------------------------- 324  Hahella...
Q606F9              314 -----------------gyrlklyfpgsngdrfdvfanvrD-AE-W---------------------------------- 340  Methylo...
CDK99780            296 ---------------fylkktharngangdypydvfrkivR-VE-W---------------------------------- 324  Magneto...
Q7MGC9              313 rktlaqslakktaiaiangdedalkrigsvvpfdvfhrvsR-AE-W---------------------------------- 356  Vibrio ...
rhodo:RCAP_rcc00376 274 ----------------yfltrngrrqhntelvldsfkqfeR-VE-W---------------------------------- 301  Rhodoba...
Q3IZ53              272 ----------------yvlkqkgtrwrdddmvldsfhqiqR-VE-W---------------------------------- 299  Rhodoba...
Q5NEB2              305 ------------glkiahenknpkkhkmpshafdifdkvkE-AE-W---------------------------------- 336  Francis...
EIC31280            345 tkse-----kihhflteyeehekqsyiesqkgfdvfkciaG-VD-W---------------------------------- 383  Methylo...
EFN59045            312 lvtegspvvghsiqaaglrnldgqyvtsvrrgselvhavgpefmlatgdvlylsglpdgtdkltelglvpfsdaleeine 391  Chlorel...
WP_011737737            --------------------------------------------------------------------------------      Candida...
Q2SNX0                  --------------------------------------------------------------------------------      Hahella...
Q606F9                  --------------------------------------------------------------------------------      Methylo...
CDK99780                --------------------------------------------------------------------------------      Magneto...
Q7MGC9                  --------------------------------------------------------------------------------      Vibrio ...
rhodo:RCAP_rcc00376     --------------------------------------------------------------------------------      Rhodoba...
Q3IZ53                  --------------------------------------------------------------------------------      Rhodoba...
Q5NEB2                  --------------------------------------------------------------------------------      Francis...
EIC31280                --------------------------------------------------------------------------------      Methylo...
EFN59045            392 telpglsgtfgvstisvpkvghlktvdsqgdvsfsppelveatirkdsdivgqtirgsafrsrfhaavvaikrngmplkw 471  Chlorel...
WP_011737737            --------------------------------------------------------------------------------      Candida...
Q2SNX0                  --------------------------------------------------------------------------------      Hahella...
Q606F9                  --------------------------------------------------------------------------------      Methylo...
CDK99780                --------------------------------------------------------------------------------      Magneto...
Q7MGC9                  --------------------------------------------------------------------------------      Vibrio ...
rhodo:RCAP_rcc00376     --------------------------------------------------------------------------------      Rhodoba...
Q3IZ53                  --------------------------------------------------------------------------------      Rhodoba...
Q5NEB2                  --------------------------------------------------------------------------------      Francis...
EIC31280                --------------------------------------------------------------------------------      Methylo...
EFN59045            472 tgtqigdevlkagdtllldvapqfwtspavneaftdlhkggqvrshneflmgmrvtkamagktvqksgmrqlpnaflvai 551  Chlorel...
WP_011737737            --------------------------------------------------------------------------------      Candida...
Q2SNX0                  --------------------------------------------------------------------------------      Hahella...
Q606F9                  --------------------------------------------------------------------------------      Methylo...
CDK99780                --------------------------------------------------------------------------------      Magneto...
Q7MGC9                  --------------------------------------------------------------------------------      Vibrio ...
rhodo:RCAP_rcc00376     --------------------------------------------------------------------------------      Rhodoba...
Q3IZ53                  --------------------------------------------------------------------------------      Rhodoba...
Q5NEB2                  --------------------------------------------------------------------------------      Francis...
EIC31280                --------------------------------------------------------------------------------      Methylo...
EFN59045            552 dragatlhavspdeelevddilwfagnaasvrfirntpglvplaekhaskllhtavverrlvqaivapesplvgttires 631  Chlorel...
WP_011737737            --------------------------------------------------------------------------------      Candida...
Q2SNX0                  --------------------------------------------------------------------------------      Hahella...
Q606F9                  --------------------------------------------------------------------------------      Methylo...
CDK99780                --------------------------------------------------------------------------------      Magneto...
Q7MGC9                  --------------------------------------------------------------------------------      Vibrio ...
rhodo:RCAP_rcc00376     --------------------------------------------------------------------------------      Rhodoba...
Q3IZ53                  --------------------------------------------------------------------------------      Rhodoba...
Q5NEB2                  --------------------------------------------------------------------------------      Francis...
EIC31280                --------------------------------------------------------------------------------      Methylo...
EFN59045            632 rfreqfnaavvavarkgerirakpgdielrsgdillldtgsafaeqhkasglpagaflfwpapaarlqdskhfqliiemp 711  Chlorel...
WP_011737737            --------------------------------------------------------------------------------      Candida...
Q2SNX0                  --------------------------------------------------------------------------------      Hahella...
Q606F9                  --------------------------------------------------------------------------------      Methylo...
CDK99780                --------------------------------------------------------------------------------      Magneto...
Q7MGC9                  --------------------------------------------------------------------------------      Vibrio ...
rhodo:RCAP_rcc00376     --------------------------------------------------------------------------------      Rhodoba...
Q3IZ53                  --------------------------------------------------------------------------------      Rhodoba...
Q5NEB2                  --------------------------------------------------------------------------------      Francis...
EIC31280                --------------------------------------------------------------------------------      Methylo...
EFN59045            712 dtnpprylhtaiaiasiATAFtlyatsiidilpaativvaimlltgcmspdqarrsirwdvylMIAGSFGVsaALEQSGg 791  Chlorel...
WP_011737737        321 -----------------DTLL------------------------------------------FFFGVILSvgGLGFMG- 340  Candida...
Q2SNX0              325 -----------------DTLL------------------------------------------FFFGVIFCvgGLATLG- 344  Hahella...
Q606F9              341 -----------------DTLL------------------------------------------FFFGVVFAvgGLGYIG- 360  Methylo...
CDK99780            325 -----------------DTLL------------------------------------------FFYGVMMCvgALGVLG- 344  Magneto...
Q7MGC9              357 -----------------DTLL------------------------------------------FFYGVVMCvgGLSLLG- 376  Vibrio ...
rhodo:RCAP_rcc00376 302 -----------------DTLL------------------------------------------FFFGIIFAvgGLGVLG- 321  Rhodoba...
Q3IZ53              300 -----------------DTLL------------------------------------------FFFGIIFAvgGLGVLG- 319  Rhodoba...
Q5NEB2              337 -----------------DTLL------------------------------------------FFYGILVSvqGLAALG- 356  Francis...
EIC31280            384 -----------------DTLL------------------------------------------FFYGAMMIvgALSFLG- 403  Methylo...
EFN59045            792 aaaIANLIVDIGknag------ggnfTIaAVYVATTLISQIIANNSAaalmfpiaATISKNdN--VDIYLLSYAIM 859  Chlorella v...
WP_011737737        341 ---YLALTSETMyls--------lgaT--YSNILVGVLSAIVDNIPVmf----avLSMNPD-MslGHWLLVTLTIG 398  Candidatus ...
Q2SNX0              345 ---YLQMMSHGMydn--------wgpT--IANIVAGTISAVVDNIPVmf----aiISMEPD-MdvSQWLLITLTAG 402  Hahella che...
Q606F9              361 ---YLELASVAMydg--------lgaT--TANIIVGLLSAVVDNIPVmf----avLNMNPD-MdiYQWMLVTLTAG 418  Methylococc...
CDK99780            345 ---YLSLMSNVLygq--------lgaT--YANVIIGVLSAILDNIPLmf----avLTMQPD-MslGQWLMITLTAG 402  Magnetospir...
Q7MGC9              377 ---YLEVVSFTLytk--------wdpV--WANITVGFLSAIVDNIPVmf----avLSMEPS-MslGNWLLVTLTAG 434  Vibrio vuln...
rhodo:RCAP_rcc00376 322 ---YLDMLSVALydg--------lgaT--AANTILGIMSAVVDNIPLmf----avLTMEPD-MshGQWLLITLTCG 379  Rhodobacter...
Q3IZ53              320 ---YLTLASELLytd--------lgpT--AANIIIGALSAIVDNIPLmf----avLTMDPA-MshGEWLLITLTCG 377  Rhodobacter...
Q5NEB2              357 ---YLGIASQYIytdmqsiapslfsaHT-QANTIIGILSAIIDNIPVmf----avLSMNPT-MehAQWLLITLTAG 423  Francisella...
EIC31280            404 ---YLDAMAHYLftv--------igaT--VANILIGLSSSAIDNGTLmf----avLNMHPS-FefGQWLLLTFTLG 461  Methylomicr...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap