Conserved Protein Domain Family
Terminase_2

?
pfam03592: Terminase_2 
Terminase small subunit
Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site.
Statistics
?
PSSM-Id: 397583
Aligned: 41 rows
Threshold Bit Score: 60.8238
Threshold Setting Gi: 268613757
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA194094:J421_4674   8 LTPKQQRFVEEFIVDLNATQAAIRAGYSARV---AANIGYENLQKPQIAAAIREAKAARSLRTQIEADDVLQRWWDLANA 84  Gemmat...
WP_014939771            6 LTPKQRKFANEYIKTNNAYQSAINADYSKAY---ARNATKFLLENIGIQQFIHRKTGKAEAETEITTDMVIANLLKTAAG 82  Lactob...
WP_011101110            5 LTPKQRKFANEFIKTNNAYQSAINAGYAKGT---ARNATKQLLENTGIHEYIIKKTGNVEKRESEEADEVLKNIYRISAG 81  Lactob...
ERK51095                6 LTEKQKRFCDEYLIDLNATQAAIRAGYSEKT---ARQTATENLSKPYIREYIDKRLAEKDAELIADQDEVLKYLTSVMRR 82  Eubact...
BAK60596                3 LTKKQQDFADYYIELGSAEEAAIKAGYSKNY---ARASAYKLLANVGIKKYIDKQITKMASERIMGAQEILERLTLIAKA 79  Lactoc...
CDA50200                6 LTEKQKRLVDYFIETGNQTEAAIKAGYSKKN---ARFIASKTLDLPYVKAFREKRLKAIEENRIAKAKEVMEFLTSSMRG 82  Dialis...
CDC21614                1 MTPKEKKFADEWLIDCNGTRAYMAAYPNVKNnksAGVLANKLLAKASVRQYVDGKLAELSSKKIASAEEVMEYLTSVLRG 80  Eubact...
WP_020457818            3 LTEKQKAFCDYYIETLNATESYKKAGYKVKTdgaARVNASRLLTNANVRKYIEERMKQKESERIASQDEVLEFLTRVMRG 82  Hungat...
Q3ABI3                  4 LTEKQKRFIDYYIETGNAAEAARRAGYKGKN---LDVIGSQNLVKLRI--YIEEKMKQKDNERIASQDEVLEFLTRVMRG 78  Carbox...
WP_011722253            3 LTPKQKAFADYYIQLGNATEAAIKAGYNKKT---ARQIGSMNLTKVDIKNYIQERMTQLEDKRIAKAEEVLQYLTRVVRG 79  Clostr...
PRJNA194094:J421_4674  85 NP-----------------------------NELVEvqrrscrychgrggmyqrtavelqrdrakydleraawerkkkra 135 Gemmat...
WP_014939771           83 ISskhrltty-------------dhlkqkltSDKTY-------------------------------------------- 105 Lactob...
WP_011101110           82 KEierhyvkidnlakevaggddsiearmeymTDETT-------------------------------------------- 117 Lactob...
ERK51095               83 EK-----------------------------NEHIV-------------------------------------------- 89  Eubact...
BAK60596               80 EI-----------------------------TETVVvanad--------------------------------------- 91  Lactoc...
CDA50200               83 EI-----------------------------KEEVVvvegtggg------------------------------------ 97  Dialis...
CDC21614               81 VS-----------------------------SAEVIvvegigdg------------------------------------ 95  Eubact...
WP_020457818           83 QE-----------------------------VEEVVgftey--------------------------------------- 94  Hungat...
Q3ABI3                 79 LE-----------------------------TEEVVvtenkgdy------------------------------------ 93  Carbox...
WP_011722253           80 EE-----------------------------NEPLAvqeqepvigedg-------------------------------- 98  Clostr...
PRJNA194094:J421_4674 136 adafpafdeqggigydprrdpnpkcqrcwgdgvarvlVKDTRRLSPAALRLYAGVKETQh--------GVDVRMRDQDGA 207 Gemmat...
WP_014939771          106 --------------------------------------------------------------------TGPPTVKDQVAA 117 Lactob...
WP_011101110          118 --------------------------------------------------------------------ITPASTKEQVAA 129 Lactob...
ERK51095               90 -------------------------------------VTTSEEKTTYVPDETGKVRRQTvkkevpqivEIPAKLSDANKA 132 Eubact...
BAK60596               92 ---------------------------------------------------------------gyaevEKPPDFKTQIQA 108 Lactoc...
CDA50200               98 -------------------------------------------------------------cseaktiEKQIGANDRIKA 116 Dialis...
CDC21614               96 -------------------------------------------------------------ysearavQKKPDEKEKLKA 114 Eubact...
WP_020457818           95 ---------------------------------------------------------------gavkeKKTPSARDRVKA 111 Hungat...
Q3ABI3                 94 -------------------------------------------------------------iseakiiKKQVSAKDRVKA 112 Carbox...
WP_011722253           99 --------------------------------------------------------kkkgyrtvtkviNIGPNIKDRNKA 122 Clostr...
PRJNA194094:J421_4674 208 LLNVAKHL---------GMlvERvetRDKTIE 230 Gemmatirosa kalamazoonesis
WP_014939771          118 AQLVLQMA------------------GKLKAD 131 Lactobacillus buchneri
WP_011101110          130 AELWFKLS------------------GRLKND 143 Lactobacillus plantarum
ERK51095              133 AELLGKAH---------GL--YT---EKI--E 148 Eubacterium ramulus ATCC 29099
BAK60596              109 MKELLKRYpgndklleqTL-------RKLTAE 133 Lactococcus garvieae Lg2
CDA50200              117 AVQLAKRY---------GL-------DKLEDN 132 Dialister sp. CAG:486
CDC21614              115 AELLGKRY---------GL-------FTDKLE 130 Eubacterium sp. CAG:274
WP_020457818          112 AELLGKRY---------AL-------FTEKVN 127 Hungateiclostridium thermocellum
Q3ABI3                113 AELLGKRY---------AL-------FTEKVN 128 Carboxydothermus hydrogenoformans Z-2901
WP_011722253          123 AELLGKRY---------RL-------FTEKVE 138 Clostridium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap