3QOE


Conserved Protein Domain Family
Peptidase_S48

?
pfam03574: Peptidase_S48 
Peptidase family S48
Statistics
?
PSSM-Id: 397573
Aligned: 3 rows
Threshold Bit Score: 284.164
Threshold Setting Gi: 169884720
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3QOE_A                     57 YLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEK 136
dbpsupku:SYNPCC7002_A0423  55 YVEQGGNLRMTGHLHHIEPKRVKAIVQEIEQGLQAGQRLQHAAFQEPTYLTELPQVWLGQYPWHRSQPRLTGDRLSEDQQ 134 Sy...
jgi:GEI7407_2094           55 YLEQGQNLRMTGHLHHIEPKRVKVIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWLEQYPWMPGRPRIPGTSLTSEEK 134 Ge...
3QOE_A                    137 RQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSP 205
dbpsupku:SYNPCC7002_A0423 135 TYLEAKLPPDLPAAQGISSAEFADLIAFLHQQAQAKTPGDRPLPLSEALAEHIKRRLLHAETVMRLDNP 203 Synechococcus...
jgi:GEI7407_2094          135 RQIEEKLPSLLPDAQLINSFQFLELIEFLHARSQEDVPAERRLPLSEALAEHIKRRLLYSGTVTRIDSP 203 Geitlerinema ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap