3CSK


Conserved Protein Domain Family
Peptidase_M49

?
pfam03571: Peptidase_M49 
Click on image for an interactive view with Cn3D
Peptidase family M49
Statistics
?
PSSM-Id: 397570
Aligned: 105 rows
Threshold Bit Score: 642.998
Threshold Setting Gi: 123483324
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CSK_A            154 INELIDIGIYHVEEKAALLGFPSQGy--TSAYYLGLp----VTPEDMALLKeQLFAEL--AILPENTRINK-VGENs--- 221 baker's yeast
XP_001324003      133 LLDECIEDIYDVSGPKSQLGFNPDG---CTVYYQPDd----FTQSEAEGID-QVLKAA--GVRIENTAIIR-HADK---- 197 Trichomona...
Q22KE9            144 VWENTNYELYAYHNPYQIIEFINNQg--HTSYYSSN-----ISQQNAEQIS-KFMEQKdiNLSPLNTRLLK-HSETe--- 211 Tetrahymen...
A0DXU3            136 VWENVRKYIYNYDKPYGLIDLQEKNg--SNSYYSNN-----LKGELLEAVD-KFLIAQ--GVSELNTRVVK--VEEe--- 200 Paramecium...
A0E5G8            143 IWNLIEKYIYSYEKPYGLLDLLEKGg--SNSYYSPN-----LSKEFIEELD-QFLHKQ--NLSELNTRVIL--KEDr--- 207 Paramecium...
Q0CEW8             84 LCKQCGPAICASTP--SHLGYPSRIa--QSSYYVGQv---qITREEIDQLA-PLLVKA--NIRPRHSRVCKdLDETgah- 152 Aspergillu...
XP_011106984      134 IYERISDAMYSTMP--LCLGYPSETgqaQSRYYISSgdaepFTKDEISSIS-QILQDR--GIHQENTEFVKkLSRAdn-- 206 Dactylelli...
EMD90822          129 LYEKISNAIKAMPP--YGLGFPSHTa--QSMYYPGDs---iITRDEISEVS-RVLEKH--SIFPENTRIQKvSNTKaq-- 196 Bipolaris ...
KLU89104          128 lYEAISDAIRMRPP--FSLGYPGESt--QSSYYLGPa----ITEQEIAAVT-RVLEQN--SIFPENTRLRKaPNGKd--- 193 Magnaporth...
jgi:THITE_2147951 129 LYDEISPAISAIPP--FSLGFPSATt--QSSYYLGA-----LTPQEITSVD-RLLEQQ--SIFPENTRLQKpADTTtggt 196 Thielavia ...
3CSK_A            222 -----FQIWV--ASenvknqiTETYPSGQITLS-NAVt-K---VEFIFGDHSREMRLVASYLKEAQKFAANDTQKAMLQE 289 baker's yeast
XP_001324003      198 -----YEVSV--AS-------IEVDEKGQKVGTyNGK--D---VYVTKGRSSEALKKVVKHLNEALKNVANDTQAEMIKC 258 Trichomona...
Q22KE9            212 -----YEILV--AS-------ITKDLQPEKDYEfEGL--K---IKITYGDFKPFLASLNGYLEKCIKHAENDHQVEMIKS 272 Tetrahymen...
A0DXU3            201 -----IHVLV--AS---------VNKGEKELGEvHNH--K---VKLVYGDFSPFLNSVVTHLTQALQYAANDNQKNMIQA 259 Paramecium...
A0E5G8            208 -----VELLV--AS--------SERSDVVELGEvKGK--K---VFAIYGDFKSFLNGVATNLREAQKYAANETQVKMLEE 267 Paramecium...
Q0CEW8            153 ---vvFNILQ--ASv-----dKSDSPEPLGTLSnGAP------VTSTKGDHSLELDKINTHLRAARQVTDHPLRVEFLSY 216 Aspergillu...
XP_011106984      207 ----gYSFTVfqASi-----dLPEAPILLSSTMrEGKefT---VVLLKANHRKQLEKINDELTAALAYCANDRQKLVLQK 274 Dactylelli...
EMD90822          197 ----iFKVLR--ASv-----eHDIQPSILEIPSlGAT------IEIKCGDHSEDLARICNSLSEAKKYAANKKQEDFLSQ 259 Bipolaris ...
KLU89104          194 -----YEVLV--GSv-----vRDDRGASGTTKTlPLGddQkgiVTIVRGDHSADLERICTELSSAVEHAANDLQRQFLAA 261 Magnaporth...
jgi:THITE_2147951 197 tstptINILV--ASa------QPTPPPTRLPSTiPTTkaN---IHLRKGDHSGPLRAICTELSFASAHAATEAQRAVLRG 265 Thielavia ...
3CSK_A            290 YINHFVTGSSQAHKEAQKLWVKDISPVIETNIGFIETYREPSGIIGEFESLVAIQNKERTAKFSSLVNNAEE--FISLLP 367 baker's yeast
XP_001324003      259 LIEHFTTGSVAAHVKYSEHWVKDVDPVVETHTGFIENYRDPKGCRCEFEGLVSCVDKNESVALHNFVDSSAT--ILKLLP 336 Trichomona...
Q22KE9            273 YLKHFENGSIDEHKNSQRHWIKDKGPIIETNIGFIESYLDPLKVRAEFEGFVSVVNKEESKKLEELVSKAEG--IISHLP 350 Tetrahymen...
A0DXU3            260 YIEHFQTGDVELHKSSQRHWIKDKGPVIETNIGFIETYLDPLKVRAEWEGFVAVVNKEESALLNELVNKAED--IIKYLP 337 Paramecium...
A0E5G8            268 YIKHFQSGDIEQHKESQKHWIQDKGPIIETNIGFIETYLDPMKVRAEYEGFVSIVNQEESKLLGNLVEKAED--IIKDLP 345 Paramecium...
Q0CEW8            217 YERYFQTGDMGLFDNAQRVWMKDKQPRVETFFGFNHKYRDPAGARAEFQGFVGLLDSDGSRELNALQQDAQK--YIATLP 294 Aspergillu...
XP_011106984      275 LIESFKTGDMEAYKESQRHWVKDIQPAVENIFGFVEPYRDPAGVRAEFEGLVGLVDKDETRTLTALAENSAR--FIRLLP 352 Dactylelli...
EMD90822          260 YIESFRTGDLEAYRNSQRTWITDKSPRVENIFGFVEPYRDPYGIRAEFEGLVAIMDLEETSKLTMLVESSGI--FIKRLP 337 Bipolaris ...
KLU89104          262 YIESFRTGNLEMYRESQRLWVRDRAPRVENIMGFVEPYRDPHGVRAEFEGLVAIADDEETALLTKLVQNSAK--FIRRLP 339 Magnaporth...
jgi:THITE_2147951 266 YLASFETGDLHAYRAAQRAWVRDITPRVESVLGFVEPYRDPAGVRGEFEGIVGFVDAEGEKGLARLAVGDGGrwLVRRLP 345 Thielavia ...
3CSK_A            368 WS------KD--------YEKPIFNPPDFTSLEVLTFTGSGIPAGINIPNYDDVRLKIGFKNVSLGNIL-------SAAA 426 baker's yeast
XP_001324003      337 YP------KE--------YERATFNPPSYNALNILQMTSTGYPIGINIPNYDEIRLNVGFKNVTLSNVL-------SSVA 395 Trichomona...
Q22KE9            351 WP------KE--------FEVEKFTKPDFTSLEVLTFASSGIPIGINIPNYDDIRQTEGFKNVNLGNVY-------STPK 409 Tetrahymen...
A0DXU3            338 WP------KE--------FEVDVYKRPDFTSLEVLAFASSGTPLGINIPNYDDIRQTEGFKNVNLGNTI-------GKLS 396 Paramecium...
A0E5G8            346 WP------KE--------FEIEKFSRPDFTSLEILAFACSGTPVGINIPNYDDIRQNLGFKNVNLGNVY-------GKPN 404 Paramecium...
Q0CEW8            295 WVd----gLQgqggangpFEMDEFQAPDFNAVYALAYAATNIFTGLSMPAFCDNWIDYAWKNLMVKTRD-------QALR 363 Aspergillu...
XP_011106984      353 WTk-----GFtdndgkgpFEKELFEAPDFTSLHTLAYCSSIIFPGINLPNFNDIRQETGFKNVMIANSMnppgrdsGADH 427 Dactylelli...
EMD90822          338 WA------GGdendgkgvFEKALFEPPDFSSIHSLAYCSSIIFPGINLPNYNDIRDELGFKNVIIANRM-------CAEG 404 Bipolaris ...
KLU89104          340 WA-------SeendgkgpFEKSLFEPPDFSSIHALAYCSSIIFPGINLPNYNDIRQEVGFKNVIVANRM-------AADS 405 Magnaporth...
jgi:THITE_2147951 346 WViasggeGGeggggmgpFEKDGVEANGLASVHALAYCSSIIFPGINLPNYNDIRQEVGFKNIIFANRM-------RVES 418 Thielavia ...
3CSK_A            427 --KsSSKhpPSFISQEDRPIFEKYQSDSFEVQVDIHELLGHGSGKLL-TEFTDG-FNFDKENPplg-ldGKPV-STYYKV 500 baker's yeast
XP_001324003      396 --VqKSV--LDILDPSIRDVFSEYCEQIESLAVAAHELYGHGSGRLLkQKDIEGgKVDDLLNP------GRKVeTCWPED 465 Trichomona...
Q22KE9            410 ----KEN--VLFANEATAELYCKYFKDSLFVIVALHELLGHGTGKLF-QKKEDDtLNFDQEHLlhp-ilNTKI-DTYYDK 480 Tetrahymen...
A0DXU3            397 ----KDA--IKFLDEADQEIFYKYQSEAVFLVVALHELIGHGAGKVF-MKDKDGnLNFNLENTinp-ltNQKV-DSYYNH 467 Paramecium...
A0E5G8            405 ----RDS--VRFLQGTDIDLFINYYKESLFVVVALHELIGHGSGKIF-MEDKDGkLNF--ENVtnp-ftNEKV-TTFYKP 473 Paramecium...
Q0CEW8            364 vgElSQGepAWFIAEAERTTYLQHVDQSVTFKVALHELFGHGTGKLL-SQLGPDeYNFDIKNPpmnpltGTPI-TSWYSQ 441 Aspergillu...
XP_011106984      428 --SlPQE--AIRVDPSLESEYIKHYQATFYLWVVFHELLGHGTGKLL-TENSDGsFNFDKENPpinpvdGKPV-SSWYKP 501 Dactylelli...
EMD90822          405 --KkARG--SPFIDPAELDSFQKANYPAYYWWVVLHELFGHGTGRMM-VEESEGkFNFDIHNPpvspltGKPI-TTWYKL 478 Bipolaris ...
KLU89104          406 q---AMQ--YPFINPSEVEQFKKHKFPAYYWWVVLHELLGHGTGRMM-VEKEYGqYNFDVNNRpinpltGKPI-SGWYKL 478 Magnaporth...
jgi:THITE_2147951 419 q---AKQ--YPFIDPAEAETFAKHKFPAYYWWVVLHEILGHGTGRML-VESAEGkYNFDINNPpinpltGEPI-TSWYKP 491 Thielavia ...
3CSK_A            501 GETWGSKFGQLAGPFEECRAEVIAMFLLTNKKILDIFGFHD--VESQDKVIYAGYLQMARAGLLALEYWNPKT--G---- 572 baker's yeast
XP_001324003      466 GTSFDQMFGACSSAYEECRAETTAVYLTFFDEVLDIFNVAKd-KSVRRNFLFVTIVKMLVAGLRSMWCYSAEA--K---- 538 Trichomona...
Q22KE9            481 NETWHSKFGDISSSYEECRADSVAIYLSCFQESLDILIPEYs-KEEQSDLVYIAWYEIVVSSIKGLEYYNPEL--K---- 553 Tetrahymen...
A0DXU3            468 GEQWHSKFGEFSGAMEECKADATALYLSTYDDVVKLLLPNQs-EEERRNTVFAGWLFVVHRAVQGLEFYNPEQ--K---- 540 Paramecium...
A0E5G8            474 NEHWHAKFGELSGAYEECRADSVALYLSTYDDVVQILVPGKt-KEERDEIVKAAWLDIIMGALKGLQYYSAEQ--S---- 546 Paramecium...
Q0CEW8            442 EQRTSSVFGEMDMSLEECRAEAIAAYLAFDKGILSTMGYSDssDITADDc--------------RFSIWQEQKerKaavi 507 Aspergillu...
XP_011106984      502 GETWTGLFGDIATSVDECRCEVVGALLVRFPGVVGFFGYTDetHTTPKDMELNIYLQLGCAGLRALNNYIVED--K---- 575 Dactylelli...
EMD90822          479 GQTWTGQFGDLATTVDECRAELVGAYLMDDVELLELLGYDEnsEITAADLTYNIYLQLGTDGLRGLANFNVEH--K---- 552 Bipolaris ...
KLU89104          479 GQTWTGQFADLATTVDECRAELVGAYLMDDSELLELLGFTAtsEIRAEDLTYNLYQQLGMDGLRGLSNFNTDS--G---- 552 Magnaporth...
jgi:THITE_2147951 492 GQTWTGQFGDLATTVDECRAELVGAYLMDDPEVLALLGFTEdlEIRAEDLTYNLYQQLGVDGLRGLANFNVDS--G---- 565 Thielavia ...
3CSK_A            573 KWGQPHMQARFSIMKTFMkhSTDkNFLKLEMNStNd--dFAIKLDKSLIKTaGHECVKDYLKHLHVYKCSGDVEQGSKYF 650 baker's yeast
XP_001324003      539 RWTQAHSAARFAILRACI--MWGrGAAEVKKLPdGg---YQLFVDINKLDG-IQDAITRLLKHLTYYKSTCLPGPGADFF 612 Trichomona...
Q22KE9            554 KWGQAHTAAAYAITKVLIe-AGQ-GLVTIEKTEkEgkpyVYIHLDKSKIWTvGKEAMRKFLIGLQVYKSTGDSVRGIEFF 631 Tetrahymen...
A0DXU3            541 KWGQAHVLARNVILQSLI--REDpDIIKITETQlNgkpyIHFKFDQSKLYTtGKKAISNLILHLQVFKSIGAGNQGVEFF 618 Paramecium...
A0E5G8            547 KWGQPHILASYVILQSII--QKDpSFVQFVHSEfNnkpyFTVQVDYSKIWTvGKEAIADLLKGLQVYKSVADGENGMKFF 624 Paramecium...
Q0CEW8            508 KWTSAHDRARFGILRTLM--AAD-NFMRVVYEEdPp--lLTVHIDRARLESiARPAISTLMTKLHVWRCSADGPAATDFY 582 Aspergillu...
XP_011106984      576 KWGQAHSRAHFAIMRILL--QAGdDFLVIKENAqEq--tLTVYVDQTKTKThGIPALSDFLLKLHMFRSTANVKECREYY 651 Dactylelli...
EMD90822          553 KWGQAHSRAHFAILKCLL--TDSdGCVTVEHNAqSk--sLIVRVDRSKIIShGKPALGRMLLQLHLFRCTGDVQSCREYY 628 Bipolaris ...
KLU89104          553 RWGQAHSRAHFSILKCLL--LDGgGVLSIVHDKaNn--sLTVRVDRSKIAThGKRALGRMLLHLHMYRCTADVEACRAYY 628 Magnaporth...
jgi:THITE_2147951 566 KWGQAHSRAHFAILQCLL--RNGdGVITVTHDKaAr--sLTVRVDRSKIRThGKPALGAMLLRLHMYRCTADVAACRTYY 641 Thielavia ...
3CSK_A            651 IDRSTVTPDLASLRDIVl---sKRLPRRQFIQSNSYID-------DNNK--VT-LKEYDETPQGMLQSFLDR 709 baker's yeast
XP_001324003      613 AAMTAIDDRWMAVKKFI-----DAQPRKRPAYCGGVVRge----aGNYK--IEsVVQDKATPLDVALTFVEN 673 Trichomonas vagina...
Q22KE9            632 NKYLAVDDEMLEYRKIAl---dNKKPRKLSLQSHVKLV--------GNEenVE-LVNFESTFEGLIKSFTHH 691 Tetrahymena thermo...
A0DXU3            619 SNLAAVSDKFLNYRNIVi---qNKFPRRLEIQPNLVLE--------EGQ--VN-LKEYEPTLAGIIESQVEH 676 Paramecium tetraur...
A0E5G8            625 NKFTQVDQKFLQLREIVl---aHKQPRKIELQPDVKLN--------NGQ--VE-LVVFPESHEGVIQSHIFH 682 Paramecium tetraur...
Q0CEW8            583 GQLTEVDGVWLRIREVVvdrvkNQAPR-LFVQANTILEegtidsdTGPR--VR-VVEYDTTVEGVIQSWCER 650 Aspergillus terreu...
XP_011106984      652 EELTEPSEQFLRWRHIIi---aNAAPPKLFVQDNTIIN-------SDGE--VV-LLGYSPTLEDLVDSWVDR 710 Dactylellina hapto...
EMD90822          629 EELSSVHAEHLAWREIVl---aKQEPRWVFVQANTFLR--------GEE--VV-LQEYPATVKGVIQSWAER 686 Bipolaris maydis C5
KLU89104          629 EDLSRVDGEYLEWRETVl---aNKPPPMVFVQANTLLG-------DDGS--VS-LKEYEPTVEGIIQSWAER 687 Magnaporthiopsis p...
jgi:THITE_2147951 642 EDLSRVDEEHLAWREAVl---aNKPPPLVFVQANTFLE--------GDR--VV-LKEYEPTVEGVIQSWAER 699 Thielavia terrestr...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap