3S6P


Conserved Protein Domain Family
Peptidase_A21

?
pfam03566: Peptidase_A21 
Click on image for an interactive view with Cn3D
Peptidase family A21
Statistics
?
PSSM-Id: 397567
Aligned: 3 rows
Threshold Bit Score: 736.832
Threshold Setting Gi: 81982128
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3S6P_D   2 GDAGVasqrphnrrGTRNVRv----------------------------------------------------------- 22  Helicoverpa armigera ...
Q9YRB2   1 MDANV---------QIRPARnn---------------------------------------------------------- 13  Nudaurelia capensis b...
Q80IX5  54 ASANQagkrleprkRTRSIRsrqdldtmhrvvvsvdvdslttlmgnimtlagsggrgslltagdveknpgpqmtrenkap 133 Providence virus
3S6P_D  23 ----sANTVTVNGRRNQRR--RTGRQvsppdNFTAAAQDLAQSLDANTVTFPANISSM-PEFRNwAKGKIDLDSDSIGWY 95  Helicoverpa armigera ...
Q9YRB2  14 ----pSQGNQGRNNNNKRRrrRRGLKlppvvAPITSPGQMAEPANHANTRVNRGRTRV-RGLRQ-AMMESPMAATSEAWI 87  Nudaurelia capensis b...
Q80IX5 134 nmsvrAQNVTVSNSRRRRRknRKPRK-----QVEQATILKPQLLPGESVAPSGGRGTMdPPVHEiCAQSIDPSEGAVGWF 208 Providence virus
3S6P_D  96 FKYLDPAGATESArAvgEYSKIPDGLVKFSVDAEIREIYNEECPVVTDVSVPLDGRQWSLSIFSFPMFRTAYVAVANVEN 175 Helicoverpa armigera ...
Q9YRB2  88 HDYLDPDGEYKTS-L--DDGKIPDGAIPQSTCGQFRGTVGARYPGLNSTTLPLDGGTWPLLVMHLPFFRHPLLFITTTSN 164 Nudaurelia capensis b...
Q80IX5 209 YKYMDPAGAVESGkAlgEFSKVPDGLLRYSVDAEQRPIVTIECPTVSESDLPLDGKLWRVSFISFPAFRLNFIALANINN 288 Providence virus
3S6P_D 176 K--EMSLDVVNDLIEWLNNLADWRYvVDSEQWINFTndTTYYvrirVLRPTY---DVPDPTEgl-vrTVSDYRLTYKAIT 249 Helicoverpa armigera ...
Q9YRB2 165 TevEVTNADLDAFANDWNNRTDWTE-ATYPSWAQVG--NVFY----MVVPTEaltDVPPPTQlgvsgLLESYRLTSSGVT 237 Nudaurelia capensis b...
Q80IX5 289 E--ALTLETRNTFIQTLNNITNWRD-LGTGQWAQFA--PGWYysiyVLPNTYamaEIGDRTD-----SVTQFRKVYKGIT 358 Providence virus
3S6P_D 250 CEANMPTLVDQGFWIGGQYalTPTSLPQYDVS----EAYALHTLtfarpssaa--alafvwagLPQGGTAPAGTPAWEQA 323 Helicoverpa armigera ...
Q9YRB2 238 AYFNAPTLVNQGVAVIAQF--QPDKEHQKENPdivaGTTQTGGT-------------------LQLGGSGPNYTLTMTIG 296 Nudaurelia capensis b...
Q80IX5 359 FEFNAPTLIDQGWWVGAHIpvKPQSETIPAAErfsaGSMTVSASnaifqpsntvarivwsitpLPVATVALTTGTGGTNN 438 Providence virus
3S6P_D 324 SSGGYLTwrhngttfpAGSVSYVLPEGFALERydpndgswTDFASAGDTVTFRQvavdevvVTNnpagggSAPTFTVRVP 403 Helicoverpa armigera ...
Q9YRB2 297 DQVEFGG---------AAIPLPTVSMGPMPES--------GQLVFQTANLTFDVgnt--itITT------TLPPGSVTGM 351 Nudaurelia capensis b...
Q80IX5 439 TSGKFFSveid--gnvNSVWTFTAPASILAEG--------EPFAEEGDTTSFSM-------TTI------TADTVVYSVS 495 Providence virus
3S6P_D 404 PSNAYTNTVFrNTLLET------------RPSSRRL---ELPMPPADFGQTVANNPKIEQSLLKETLGCYlVHSKMRNPV 468 Helicoverpa armigera ...
Q9YRB2 352 WQFTASNGTD-TVTVDAgarlyafganldASELNLQdinSIKIPPTNMNQMMQATPKTIQFQLNETKGFY-MPLRAFQPV 429 Nudaurelia capensis b...
Q80IX5 496 SSLTGSSVIVrGVTKGSgvsitpvtvgidTEAVNRL---SIEMPALTTEEVTTNVPKYEQFLCKESGGAYiVHYKMNNPV 572 Providence virus
3S6P_D 469 FQLTPASSFGAVSFNNPGYERTRDLPDYTGIRDSFDQNMSTAVAHFRSLSHSCSIVTKTYQGWEGVTNVNTPFGQFAHAG 548 Helicoverpa armigera ...
Q9YRB2 430 FEMTMATSYGPVRWKTPRTTVVDYHRAIGGLQDTIDSNFAIGVAAMTGMSTSTVPYFKVFRRFEAIPAEGSPWGPFASAT 509 Nudaurelia capensis b...
Q80IX5 573 FEMTGEENFGGFQFHYPGYDPENNALGLRGIVDTFENNFSSAVVHFWGISQSATIVCKTYDGWEGTTNAGSTVGQFAHTG 652 Providence virus
3S6P_D 549 LLKNEEILCLADDLATRLTGVYPATDN 575 Helicoverpa armigera stunt virus
Q9YRB2 510 PPKDDVALTVARTWTDLHPFAYPERYN 536 Nudaurelia capensis beta virus isolate South Africa
Q80IX5 653 AEEEDEVVQLANRLQMELTGVYQADDN 679 Providence virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap