Conserved Protein Domain Family
Bunya_G2

?
pfam03563: Bunya_G2 
Bunyavirus glycoprotein G2
Bunyavirus has three genomic segments: small (S), middle-sized (M), and large (L). The S segment encodes the nucleocapsid and a non-structural protein. The M segment codes for two glycoproteins, G1 and G2, and another non-structural protein (NSm). The L segment codes for an RNA polymerase. This family contains the G2 glycoprotein which interacts with the pfam03557 G1 glycoprotein.
Statistics
?
PSSM-Id: 397566
Aligned: 41 rows
Threshold Bit Score: 273.724
Threshold Setting Gi: 590122439
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
YP_009117085   21 KC-------------FTGGVQFRIERSSIGGNEV-----CLKDDIAMYKIVVEYQKGDEShtkISAVMKAFVKETVQNWK 82   Maprik virus
AEE01390       26 NC-------------FQGGHVVKHEVMNHGVTNL-----CLKDDVSILKISSTQQRNKT-----MFDNTVSRFWNVKNWH 82   Oyo virus
AED98379       23 KC-------------FAGGFLVQKRVMTHGIADF-----CVRDDISMIKGTSDQLKNES-----KFTNVIHRMWNVKNWH 79   I612045 virus
BAF91638       27 RC-------------FYGGDMFRQINSTSPMSEI-----CVRDDISLVKSIGYH-KLAANrevIESSMSYYRLYYVKNWF 87   Akabane virus
CCG93480       27 KC-------------FFGGTQFRQINSTGTMSEI-----CSRDDISMVKSIGVH-RLSEDnqvMETSLTFYRLFYVKDWY 87   Sabo virus
AEA02983       20 RC-------------FHGGILIADYNSTDGKGEM-----CIKDDVSMIKIKTQS-QKDTK---PNYNVKAYRLYTVKDWH 77   Leanyer virus
AIN55742       26 YC-------------FQGGRLSIKKENVRLGHRQ-----CIRDDVSLIKQTYVKTKNDSNg--PLYEMHIYRKDTVKNWH 85   Pacui virus
AHL27170       21 VC---------------RGTHWMEVSTVTIPTNLtcisrCLSDDFGYVKVESSG-----------NTCKLSRKYT----K 70   Khurdun virus
YP_009300682   20 NC-------------GNGAVMVCEKTYSPGLSM------CLRDDLGSQSVWSDE---------KGVINYLERTL---DTG 68   Shuangao Inse...
AGX32062       29 DCdgqiekafylgtdFNITTYECKTRMTEG---------CYKSDLNYARMRLSHDTNKTI-------------LDVMKLK 86   Tai virus
YP_009117085   83 ECNPVISDNGNLNLITIENDFSISTKTYACAANCEVQVDKQHAKILLRSDSTNF--YSIK-GTLFKSGWFKNNHQIELEN 159  Maprik virus
AEE01390       83 KCNPVPVIDGTFIVYDIDKFFNVVPKVFSCKSECRIHIDKDEGCIILSSEHMNH--YTIS-GTSTTTGWFRSKTNIPLQN 159  Oyo virus
AED98379       80 KCNPIEMSGGTFTVYDVDSTMALVPKSFSCRSECRINIDKEEGAIILSSESLNH--YSIT-GSSTQSGWFKTKTSVQLSN 156  I612045 virus
BAF91638       88 ECNPVQDILGTFMVFDVNHEGILAPKTYACRATCSISLERDTGNVVLESPALNH--YTIH-GTTIKNGWFKTKVSIDLDN 164  Akabane virus
CCG93480       88 ECNPILDHMGTFMVLDISETGLLVPKTYTCRATCDINIDKDAGSVLLTSNSLNH--YSIE-GTTIKTGWFKTQAQVALEN 164  Sabo virus
AEA02983       78 DCNPVPDNTGTIQITSVSRNGDINSRIYSCRSACHITIDKEKAEIVLQSDTLNH--YEVV-GSTIMTGWFKKTSVLTLEH 154  Leanyer virus
AIN55742       86 ACNPKAVEEGPLQLLEYDQELNFHFGHYACTKHCDIKIDKEYARIELTSSGLNY--YEVL-GTINQRNWLMSKIHIDLSH 162  Pacui virus
AHL27170       71 TCSEVTSHEGYLFKYIMTKQG-VTTSRFMCTHNCEITVNQQTGEVSFASQYPNF--YKISiDEKEQHGFFNGIQVVKVVG 147  Khurdun virus
YP_009300682   69 VCDLVEAENGYLNYHLYECNAGTQTKTFVCSKSCNVETDKLNKVLHLSTHGRNY--YVISiNNDISSGWFENRKMIPIEQ 146  Shuangao Inse...
AGX32062       87 DIQIVPDQSGPFTYLDANCYG-LIKKQVSVKNFCGIEILQMEGRIRLESNGANIaiYSID-GKPPTMITFTNNYEFELGK 164  Tai virus
YP_009117085  160 TCENVEIVCGSTLMRLHSCFKEHMPCIRFLHG-KILTLDIATSICSNIELIITVSMILIFFAILALISKTYLCYLLIPI- 237  Maprik virus
AEE01390      160 TCEHITISCGTNRHTVHACFKTHMSCIRFFKN-TILPNRMSKSFCSNIEVILITSFALITYIILLILSGTYIIYLLLPI- 237  Oyo virus
AED98379      157 TCEHIVVSCGTLQKPVHACFKTHMSCVRFLHK-TMLPGQMAMSLCSNIEIILLTTFSLITYLLLWMISGTYIIYILLPI- 234  I612045 virus
BAF91638      165 TCEDLHITCGHKTLNVHACFRQHKSCIRYFKG-SILPEVMIESICTNAELILLCCFSAISCFVAIILTKTYLVYLLIPI- 242  Akabane virus
CCG93480      165 TCENIHVTCGHKTINLHACFRQHKSCIRYFRG-SILPELMIESICTNMELILLVCFLIISSIVAAILTRTYLVYLLIPI- 242  Sabo virus
AEA02983      155 TCEELTIKCGQENLDLHSCFKVHRPCVRFFSG-TYLPIFMIEKMCQNIELIILILYIIFAYIFAILITRSYIAYIFIPA- 232  Leanyer virus
AIN55742      163 TCENLIVTCGMDSVKFHACFKQHMECNRFFKN-SWVPSIIVNGFCSNIEFFLFFVFLFVTFSLLWLLAKTILCYFLMPI- 240  Pacui virus
AHL27170      148 TCVRINAKCGSHHTNMKYCFKKHRECYNFLSS-YPMPLNMVNSFCNNLEIIIMLSFILLCFILLRLIARTPLIVIFVPVl 226  Khurdun virus
YP_009300682  147 PKNKIHITCGKNSQQFVIDYKLHDEC-EIALG-DYIPRLFLRPLCSNASLILSLIFFIICMFIVILLTQYSQVRALIGTl 224  Shuangao Inse...
AGX32062      165 TKGSISVKCGSTKLNDYFVIDREYLCQDYYSGyNYIPELFYKPMCKYPIMFLTLLILVICSVIVYLIGSTPVGYLVFII- 243  Tai virus
YP_009117085  238 FIPISYVYSKIYEGCCKRCKVCGLAMHPLSSCPVVCVCGSKFENTNRLLLHRKSGL-CT----GFKVLRNTR 304  Maprik virus
AEE01390      238 MWPITYIFGKLYSKSCVKCRDCSLPMHPLSKCGTECMCGTEFGTTERLKKHRESQL-CK----GYKSGPAAR 304  Oyo virus
AED98379      235 FWPLTYICGVMYTRCCKACVTCGKPYHPLTKCGTECICGAEFGSTDRLKSHRQGRL-CH----GFKAGATAR 301  I612045 virus
BAF91638      243 FYPFVKLYGLLLQRFCKQCKNCLLPIHPFSPCPTTCICGMVYNSTEALKVHRKCLN-CT----GYKTLTKTR 309  Akabane virus
CCG93480      243 FYIPVKIYGLLYDRACRKCKNCLLAVHPFSNCPTTCICGMSYNSTEALRVHRQCMN-CT----GYKTLTKTR 309  Sabo virus
AEA02983      233 FYPLVKLYSVLYNRFFKLCPNCLLALHPFSNCTNICICGSRFPSTEALKTHRLCKN-CR----GYKALTKTR 299  Leanyer virus
AIN55742      241 YFPIVYAYSKIYMKVFKRCKSCGLAIHPLKSCGVECICGMVFESTEKLKRHRDSAIgCK----GYKTGIAAR 308  Pacui virus
AHL27170      227 YFPVKFMY-YIKAKFCVKCKTCKKAWH-FFECEPKCICGNNFSDIDRYLKHKKT---CKsqryGLQAYRQAs 293  Khurdun virus
YP_009300682  225 FFIPVYLFEKLKLKVCGTCKSCGQTVHYFRRCKKTCGCGYIGNSIDELRIHKERH--CS----GDSRLLIAT 290  Shuangao Insect Virus 1
AGX32062      244 LYPILKLYFKIIDKYMPKCRSCRLVIHPFTSCGSICKCGENFGNTQRLKAHNSGVKdCS-----RKVMIVyk 310  Tai virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap