2PNW,3CZB


Conserved Protein Domain Family
MltA

?
pfam03562: MltA 
Click on image for an interactive view with Cn3D
MltA specific insert domain
This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
Statistics
?
PSSM-Id: 397565
Aligned: 182 rows
Threshold Bit Score: 180.84
Threshold Setting Gi: 503032796
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2PNW_A            21 GQDDPRKLFPAMATILshlrnakpyrtgalgitaaELVSLLEL----AE-------------RGq-------VNSPE-QA 75  Agrobacteri...
jgi:Cha6605_5686 104 kSGDKLALLKSIDNSL-------------------RYIETPAAvrayQNyavqginrdrvrrSLvrfrqlvnKSRSAgEL 164 Chamaesipho...
jgi:Cri9333_3959  59 QPGDQQALLESIDHSL-------------------RYLQTSEAaatyQTylmpditvdrvrrSLlrfrqlvlSAKSAqEL 119 Crinalium e...
tgen:AM1_3327     56 QKGDYKALLTAIDHSL-------------------EYLGTDKAqkdyQDykvpgitrdrvsrSLrrfrqlvvQAKSPqAL 116 Acaryochlor...
WP_015181837     108 qSGDKPALLAAMAQSL-------------------RYLQSSTAaaayQKyrvsgvtrervyrSLvrfrqlvlASRSPeQL 168 Microcoleus...
WP_015126737      88 sASDKKALLTAIDRSL-------------------QYLQTARAenayKDypvpgitrdrifkSLtrfrqlllTANSPaAL 148 Calothrix s...
jgi:Cylst_1660    87 qiADKKAILTAIDRSL-------------------RYLQTSNAvaayQKypvvgvtrdrvfkSLqrfrelllTTNSPaEL 147 Cylindrospe...
WP_015215147      84 kiADKKALLASIDQSL-------------------KYFKSGRAtnayQRykipgitqdrvykSLqrfrqiliSTNSAkEL 144 Anabaena cy...
jgi:Nos7107_3796  71 elADKKALITSIDRSL-------------------QYLQTSRAiaayQKypvtgitrdriikSLnrfrelllKSQSApEL 131 Nostoc sp. ...
jgi:Cal6303_0896  88 EKGDKKALITSINRSL-------------------QYLQTQRAvkdyQDysvpeftrdrvvaSLlrfrqlvqNTQSPiEL 148 Calothrix s...
2PNW_A            76 RQFFETNSVPFRISpaqgkSG----FVTAFYEPELEVSATPDDVWRYPIYRRPPELvdidndnrpdgfdpsyafgkadEE 151 Agrobacteri...
jgi:Cha6605_5686 165 QAAVKKEFVFYQSVg---kDNkgtvTFTGYYEPIYTASRQQTAEFKYPLYKLPASF----------------------SS 219 Chamaesipho...
jgi:Cri9333_3959 120 QAAVRREFTFYQSVg---sDDkgkvLFTGYYEPVYKASKTRTAEYRYPLYRLPADF----------------------SS 174 Crinalium e...
tgen:AM1_3327    117 ETAVKKEFQFYQSIg---nDQkgnvDFTGYYEATYPASRQPTTEFRYPLYQAPADL----------------------KA 171 Acaryochlor...
WP_015181837     169 EAAVKREFVFYQSVg---kDGlgnvLFTAYYEPVYAASRVPTPEYRYPLYRRPSNL----------------------EA 223 Microcoleus...
WP_015126737     149 HTAIQREFVLYQSIg---kDTkgsvLFTAYYEPVYTASRVPTPEYRYPVYKIPPDL----------------------NS 203 Calothrix s...
jgi:Cylst_1660   148 HAAIEKEFVFYQSIg---kDGkgtvLFTAYYEPLYAASRTPTAEYRYPIYRLPPDL----------------------NS 202 Cylindrospe...
WP_015215147     145 HAAIEKEFVFYQSVg---kDNqgavLFTAYYEPLYLASRTPTKEFKYPAYRYPADL----------------------QS 199 Anabaena cy...
jgi:Nos7107_3796 132 HQAIEREFVYYQSVg---kDQkgtvLFTAYYEPLYQASRSPTDEFRYPVYRLPPDI----------------------NS 186 Nostoc sp. ...
jgi:Cal6303_0896 149 HNAITQEFDIYQSIg---sDKkggvLYTSYYEPIYTASRVPTAEFRYPIYRIPPDI----------------------KQ 203 Calothrix s...
2PNW_A           152 GISYFPDRRAIDE-----GCLRGRGl-eIAWARSKVDLFFVHVQGAARLVFPDGAIKRITYAAKAGHVFSPIGRLLLDRG 225 Agrobacteri...
jgi:Cha6605_5686 220 WKDPQPDRLMLEGadglqGSKSELAgneIFWMRDRFEAVLVQIQGSAELNLTDGTKTTVGYAGGTSFAYTSIGKELAKDG 299 Chamaesipho...
jgi:Cri9333_3959 175 WSKPHPKRADLEGvd-glGEKSLLKgaeLVWLRDRMEAYLVQIQGSAKLQLTDGSVMSVGYAGGTDYPYTSIGRELAKDR 253 Crinalium e...
tgen:AM1_3327    172 WPKPHPTRAELEGadglqASQGPLKgleLVWLRDRIQAFLVQVQGSARLGLTDGTEMTVGYAGKTAHPYTSIGKALIADG 251 Acaryochlor...
WP_015181837     224 WPKPHPTREQLEGkdglqSSKGKLRgleLFWLRDRLQAYMIHIQGSARLVLPDGKQTTVGYAGHTAYNYSSIGRALADDG 303 Microcoleus...
WP_015126737     204 WTKPHPTRLQLEGadglqGAKGKLRgleLLWFRDRLEPYMVQIEGSARIQLTNGTETTIGYAGNTAYNYSSIGRELANDG 283 Calothrix s...
jgi:Cylst_1660   203 WTRPHPPRLALEGadglqGAKGKLRgleLFWFRDRLEPYLAQIQGSARLQLTDGTQTTVGYAGNIAYNYQSIGRELINDG 282 Cylindrospe...
WP_015215147     200 WTKPHPTRLELEGadglqGGKGKLKgleLFWFRDRLEPYIIQIQGSARLKLTDGKQTTIGYAGNTAYNYKSLGRLLVDDG 279 Anabaena cy...
jgi:Nos7107_3796 187 WTQPHPTRLELEGadglqGSQGKLRgleLFWFRDRLEPYMMQIQGSARLQLTDGTKTTIGYAGNTAYNYKSIGRELANDG 266 Nostoc sp. ...
jgi:Cal6303_0896 204 WQRPHPTRLELEGadglqAEKTKLKglaFFWLRDRLEPYMMQIQGSAQLQLTDGSRTSVGYAGNSAHDYSSIGKALADDG 283 Calothrix s...
2PNW_A           226 ELDPKTISMQTIRQWLADHPDEVDGVLWHNRSYIFFR 262 Agrobacterium fabrum str. C58
jgi:Cha6605_5686 300 KVTPSQLTLPGIIRYFQENPQELDVYIPRWKRFVFMk 336 Chamaesiphon minutus PCC 6605
jgi:Cri9333_3959 254 KLSLDGMSLPVMINYFKRNPVELSNYLPRNQRFVFFQ 290 Crinalium epipsammum PCC 9333
tgen:AM1_3327    252 KFTLEELSLPVVLQYFEENPQDLDLYIPKNKSFVFFQ 288 Acaryochloris marina MBIC11017
WP_015181837     304 KLPLEGMTMPKILQYFQDNPAELNIYIPRDKSFVFFQ 340 Microcoleus sp. PCC 7113
WP_015126737     284 KLPLEGMTMPIILDYFRKYPQELNVYIPRDRSFVFFQ 320 Calothrix sp. PCC 7507
jgi:Cylst_1660   283 KLPVEGVTMPMILDYFHQYPQELNIYIPRDRSFVFFQ 319 Cylindrospermum stagnale PCC 7417
WP_015215147     280 KLPLEGLTMPIILDYFQKHPQDLDIYIPRDRSFVFFQ 316 Anabaena cylindrica
jgi:Nos7107_3796 267 KLPLQGMTMPIILNYFQQHPPELNIYIPRDPSFVFFQ 303 Nostoc sp. PCC 7107
jgi:Cal6303_0896 284 KVPLVGMTMPKILEYFHKYPLELNTYIPRDKSFVFFQ 320 Calothrix sp. PCC 6303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap