4WV4,6TB4


Conserved Protein Domain Family
TFIID_30kDa

?
pfam03540: TFIID_30kDa 
Transcription initiation factor TFIID 23-30kDa subunit
Statistics
?
PSSM-Id: 397553
Aligned: 61 rows
Threshold Bit Score: 46.3487
Threshold Setting Gi: 211589390
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WV4_A               19 TIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMK 67 
EAX89202             25 PIPDSVIKQILSECGMHTNDIRVSHIMNVVCQKFMSDVMTKCCECAKLR 73  Trichomonas vaginalis G3
EAY19760             26 pIPDSVIKHICAESGLNTTDARVTSAISVVTQKFISEVLRNCSDFAKAR 74  Trichomonas vaginalis G3
EHY65208             19 LIPDVVLDHCFTKAGLTTEDPKIKKLVSLIAQKLITDVATCAYQYHKIA 67  Nematocida sp. 1 ERTm2
ELQ75002             35 LIPDIVLDHLLERSGVDCADKETKKAISLLAQKFITDVATSSFQFHKIH 83  Trachipleistophora hominis
WGS:AFBI:EDEG_03596  24 LIPEPIIDYFLTKAGISYADQNVKKYISLIMQKFLTDVSISAFQYHKVi 72  Edhazardia aedis USNM 41457
XP_001828022         19 LLPDSVIDYFLEKNGINTKNENVKKLISLMAHKFLTDVALNAFQFHKIh 67  Enterocytozoon bieneusi H348
EPR79980             20 LIPEEVIDYFLEKAGVDTADPDVKKTIALLGQKFLTDVAESSFQFHKLN 68  Spraguea lophii 42_110
ELA42928             19 MIPDSIIESYCEKCGVETLDADVKKTVALMSHKFLTDVSVAAFQYHKMf 67  Vittaforma corneae ATCC 50505
Q8SU50               44 LLPESVTDYFMEKAGVVTSDQSVKKLVSLLAHKFVTDIAVSSFQYHRIN 92  Encephalitozoon cuniculi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap