Conserved Protein Domain Family
Spuma_A9PTase

?
pfam03539: Spuma_A9PTase 
Spumavirus aspartic protease (A9)
Statistics
?
PSSM-Id: 112362
View PSSM: pfam03539
Aligned: 4 rows
Threshold Bit Score: 306.39
Threshold Setting Gi: 82305306
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O41894   11 IKGNHLKGYWDSGAEITCVPAIYIIEEQPVGKKLITTIHNEKEHDVYYVEMKIEKRKVQCEVIATALDYVLVAPVDIPWY 90   Bovine foamy virus
Q9J4C7   11 IKGNSLKGFYDTGAEITCVPAIFLIEEEPIGERTIQTIHGITKEKVYYLTFKIQGRKLAAEVIGTQLDYVIIAPSDIPWY 90   Equine foamy virus
P23074   14 IKGTKLKAHWDSGATITCVPEAFLEDERPIQTMLIKTIHGEKQQDVYYLTFKVQGRKVEAEVLASPYDYILLNPSDVPWL 93   Macaque simian foam...
O93209   11 RKGVKIKGYWDSQADITCVPKDLLQGEEPVRQQNVTTIHGTQEGDVYYVNLKIDGRRINTEVIGTTLDYAIITPGDVPWI 90   Feline foamy virus
O41894   91 KPGPLELTIKIDVESQKHTLITESTLSPQGQMRLKKLLDQYQALWQCWENQVGHRRIEPHKIATGALKPRPQKQYHINPR 170  Bovine foamy virus
Q9J4C7   91 KKYELELTIKIDIQKQQEQLLHTTNLSSEGKKYLKDLFIKYDNLWQKWENQVGHRRITPHKIATGTLNPKPQKQYRINPK 170  Equine foamy virus
P23074   94 MKKPLQLTVLVPLHEYQERLLQQTALPKEQKELLQKLFLKYDALWQHWENQVGHRRIKPHNIATGTLAPRPQKQYPINPK 173  Macaque simian foam...
O93209   91 LKKPLELTIKLDLEEQQGTLLNNSILSKKGKEELKQLFEKYSALWQSWENQVGHRRIRPHKIATGTVKPTPQKQYHINPK 170  Feline foamy virus
O41894  171 AKA 173  Bovine foamy virus
Q9J4C7  171 AKA 173  Equine foamy virus
P23074  174 AKP 176  Macaque simian foamy virus
O93209  171 AKP 173  Feline foamy virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap