3BO6,4H43


Conserved Protein Domain Family
VRP3

?
pfam03536: VRP3 
Click on image for an interactive view with Cn3D
Salmonella virulence-associated 28kDa protein
Statistics
?
PSSM-Id: 397551
Aligned: 5 rows
Threshold Bit Score: 414.65
Threshold Setting Gi: 490359485
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BO6_B         3 PQMSATNEDLKTNFHSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGD 82  Chromobacterium...
ACR69124      24 QKMPPMNESLKNNFDTLQHQMRQMPLSHFKVEPNAPDYSEIRKSGFCTLSQGFRLSNTSDNFFIHARRQEPQYKGEFIGD 103 Edwardsiella ic...
4H43_B        24 AEIPSTNKHLKNNFNSLHNQMRKMPVSHFKEALDVPDYSGMRQSGFFAMSQGFQLNNHGYDVFIHARRESPQSQGKFAGD 103 Salmonella ente...
WP_004239258  24 KTHLPTDDYLKQHIDALLIQMKQMPVSFIKEAENAPDYPMLQQCGYSSRYNGFHLSNDCGDVFIRARREKPHCAGGFEGD 103 Morganella
Q327I2        23 PQMLSANERLKNNFNILYNQIRQYPAYYFKVASNVPNYSDICQF-FSVMYQGFQIVNHSGDVFIHACRENPQSKGDFVGD 101 Shigella dysent...
3BO6_B        83 KFHISVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDQENSQYSASSLHNTRQFIECL 162 Chromobacterium...
ACR69124     104 KFHISVQGQQVPQAFQALSELLFSGDSPIDKWKVTDMARVDQQSRVGEGAQFTLYVKPDQEDTQYSAEMLHKTRQFIAAL 183 Edwardsiella ic...
4H43_B       104 KFNISVLRDMVPQAFQALSGLLFSEDSPVDKWKVTDMEKVVQQARVSLGAQFTLYIKPDQENSQYSASFLHKTRQFIECL 183 Salmonella ente...
WP_004239258 104 KFHLSVHESQIAQAVTMLSGALFSDNNPCDRWKITDISQAEPDSRVKRGAQITLYVRPVPGEHPYSAELLSETRRFITGL 183 Morganella
Q327I2       102 KFHISIAREQVPLAFQILSGLLFSEDSPIDKWKITDMNRVSQQSRVGIGAQFTLYVKSDQECSQYSALLLHKIRQFIMCL 181 Shigella dysent...
3BO6_B       163 ESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQSQALREEPFYRLMAE 220 Chromobacterium violaceum
ACR69124     184 ESRLSENGIIPGRSPESDVHPESWQYASYRNELRSERFGDGMQGQALREEPFYRLMTE 241 Edwardsiella ictaluri 93-146
4H43_B       184 ESRLSENGVISGQCPESDVHPENWKYLSYRNELRSGRDGGEMQRQALREEPFYRLMTE 241 Salmonella enterica subsp. enterica s...
WP_004239258 184 EYRLTEGGIVPGEYPLSDIRPPHWQFTSYRNEIISGREGCEADHQRLAESAFYRLMTa 241 Morganella
Q327I2       182 ESNLLRSKIAPGEYPASDVRPEDWKYVSYRNELRSDRNGSERQEQMLREEPFYRLMIE 239 Shigella dysenteriae Sd197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap