6P0X


Conserved Protein Domain Family
SpvB

?
pfam03534: SpvB 
Click on image for an interactive view with Cn3D
Salmonella virulence plasmid 65kDa B protein
Statistics
?
PSSM-Id: 397549
Aligned: 45 rows
Threshold Bit Score: 361.544
Threshold Setting Gi: 927399369
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6P0X_A          8 SGPDGLASITLPLPISAERGFAPALALHYSSGGGNGPFGVGWSCATMSIARRTSHGVPQYNDSDEFLGPDGEVLV-QTLS 86   Salmonella en...
CBW76668       40 GGVSGAASLTLTLPTTDAGGITPALALAYSSGAGNGAFGLGVALSMPSISRRTAKGVPRYTDTDEFVDAGGEVLV----- 114  Paraburkholde...
CCH:MU9_1212   31 IGPDGASAFSVPLPVSRGRGYFPEPVLSYNSRNGNDAFGLGWTVSMAALSRRVVKGVPRYTNEDEFTDPDNEVIVpVLGS 110  Morganella mo...
Q7N7Y2         31 AGPDGMAALSLPLPISAGRGYAPSLALNYNSGAGNTPFGLGWDCNVMTIRRRTHFGVPHYNETDTFLGPEGEVLVvA--- 107  Photorhabdus ...
Q7N7Z0         31 TGPDGMAALSLPLPISAGRGYSPSLTLNYSSGAGNSPFGLGWDCNVMTIRRRTSTGVPNYDETDTFLGPEGEVLViALNE 110  Photorhabdus ...
CBJ90626        8 VGAEGGASFSLPLPISVGRGLVPVLSLNYSSTAGNGSFGMGWQCGVGFISLRTAKGVPHYTGQDEYLGPDGEVLSiVPDS 87   Xenorhabdus n...
Q7N936         31 AGPDGMATLSLPLPLSTGRGTAPGLSLLYSSSAGNGPFGIGWQCGVMTISRRTQHGIPQYGNDDTFLSPQGEVMNiALNN 110  Photorhabdus ...
CBJ81060       32 AGPDGMASLSVPLPISAGRGSAPNLSLNYSSGAGNGPFGIGWQSSTMAISRRTQHGVPQYHGEDTFLCPMGEVMAvAVNP 111  Xenorhabdus b...
WP_002210089   32 IGPSGMATLTLPLPISAGRGYAPSLTLSYSSGSGNGPFGLGWQLGTMAIRRRTNAQVPRYDEYDEFLAPNGEVMVvAADP 111  Yersinia pestis
Q87X46         41 VGTSGAASLEVALPISPGRGYAPALSLSYQSTSGNGVFGLGWNLNTSKVARRASKGVPTYANDDLIFGPGGDVCLpERDD 120  Pseudomonas s...
6P0X_A         87 TGDAPNPVTCFAYGDVSFpq-sYTVTRYQPRTESSFYRLEYWVGNSN----GDDFWLLHDSNGILHLLGXTAAARLSDPQ 161  Salmonella en...
CBW76668      115 --------RVGETADQTLndrvFHVTPYAPRIASSFDRLDYWQAQDDa---SCAFWRVQAADGTQHLFGYTQAARLADPA 183  Paraburkholde...
CCH:MU9_1212  111 DGKPVSS-PKRKLLDTDLkt-eYRVTQYRPRLETSSDLLQYWQAERDvpgcPSEFWVIFAADGQVHLFGYEDSARIYQPD 188  Morganella mo...
Q7N7Y2        108 ---DQPR-DESTLQGINLga-tFTVTGYRSRLESHFSRLEYWQPKTTg---KTDFWLIYSPDGQVHLLGKSPQARISNPS 179  Photorhabdus ...
Q7N7Z0        111 NGQADIR-SESSLQGINLge-iFTVTGYRSRLESHFSWLEYWQPKTTg---TTDFWLIYSPDGQVHLLGKNPQARISNPL 185  Photorhabdus ...
CBJ90626       88 QGQPEQR-TATSLLGTVLtq-pHTVTRYQSRVAEKIVRLEHWQPQ-QrreeETSFWVLFTADGLVHLFGKHHHARIADPQ 164  Xenorhabdus n...
Q7N936        111 QGQPDIRQDVKTLQGVTLpi-sYTVTRYQARQIVDFSRIEYWQPASGq--eGRAFWLISSPDGQLHILGKTAQACLANPQ 187  Photorhabdus ...
CBJ81060      112 SGQPDVR-QTDKLLGGQLpv-tYTVTRHQPRNIQHFSKLEYWQSLTDv--eTTPFWLMYSPDGQIHIFGKTEQAQIANPA 187  Xenorhabdus b...
WP_002210089  112 QGSIERTEQSLNGEQ-------FSVIRYLPRIEGNFHRIEYWRPRTNn--sQAPFWLVHSSDGQKHCLGYSAAARIADPL 182  Yersinia pestis
Q87X46        121 SGALVST-QVSRYNDHDLna-tYQVVRYFSRVEGAFLRIEHWRVDIA----DPGFWLIHGADGSLNLYGRRTSSRIADPA 194  Pseudomonas s...
6P0X_A        162 AASHTAQWLVEESVTPAGEHIYYSYLAENGDNVDLn-----GNEAGRDRSAMRYLSXVQYGNATPAadlylwtsatpA-V 235  Salmonella en...
CBW76668      184 TPEHIARWCLEESVTPHGEHVYYAYQGEDNSGIDTs----vPVEQPRERRAQRYLKRVCYGNRQACadlyl-msgtpVpT 258  Paraburkholde...
CCH:MU9_1212  189 NPRHIARWLINASVSPEGEQIYYRYSNEDNEGCSEdeirfhP------KQSYRYPEKICYGNKKSGrhfpc-vnnsaDdN 261  Morganella mo...
Q7N7Y2        180 QTTQTAQWLLEASVSPHGEQIYYQYRAEDNLDCETn-----EITLHPQATAQRYLHIVYYGNRTASetlpglngrapSqA 254  Photorhabdus ...
Q7N7Z0        186 NVSQTAQWLLEASVSSHGEQIYYQYRAEDETNCETd-----EFTAHPNATVQRYLQAVHYGNLTASevfptlngddpLkS 260  Photorhabdus ...
CBJ90626      165 DETRIARWLMEETVTHTGEHIYYHYRAEDDLDCDEh-----ELAQHSGVTAQRYLAKVSYGNTQPEtaffavksgipAdN 239  Xenorhabdus n...
Q7N936        188 NDQQIAQWLLEETVTPTGEHVSYQYRAEDETHCDDn-----EKTAHPNATAQRYLVQVNYGNIKPQtslfvldntppTpE 262  Photorhabdus ...
CBJ81060      188 ETSQIAQWLLEETVTPTGEHIYYQYRAEDDIGCDDs-----EKNAHPNASAQRYLAQVNYGNITPEssllvlkntppAdH 262  Xenorhabdus b...
WP_002210089  183 HPEHIAEWLLEESVSLSGEHIGYQYQAEDEQGIDEpsiykaEKQNHPAASAQRYLKRVVYGNRQAAyelyc-ltqqpApT 261  Yersinia pestis
Q87X46        195 DMNRVAEWLLDESMNAIGEHILYEYKPEDHQGLAEd--------HPRNFRAQRYLSRVRYGNAKAHyvlylwqedslDgL 266  Pseudomonas s...
6P0X_A        236 QWLFTLVFDYGERgvdPQVPPAFTA---------------QNSWLARQDPFSLYNYGFEIRLHRLCRQVLMFHHF 295  Salmonella enteric...
CBW76668      259 NWYFELVFDYGEHaadANAIPTYAP---------------QRAWCARLDPFSDYAAGFEVRTHRLCRQVLMFHRF 318  Paraburkholderia r...
CCH:MU9_1212  262 KWLFFLVFDYGQRsctLADIPGWQIp-------------aGKQWPLRQDIFSSYEYGFEIRIRRLCRQVLLFHRt 323  Morganella morgani...
Q7N7Y2        255 DWLFYLVFDYGERsnnLKMPPAFTA---------------TGNWLCRQDRFSRYEYGFALRTRRLCRQILMYHCl 314  Photorhabdus laumo...
Q7N7Z0        261 GWLFCLVFDYGERknsLSEIPPFKA---------------SSLWLCRQDRFSRYEYGFELRTRRLCRQILMFHRL 320  Photorhabdus laumo...
CBJ90626      240 DWLFHLVFDYGERsssLNSVPEFNVsennvsennvsennvSEKWRCRPDSFSRYEYGFEIRTRRLCRQVLMFHQL 314  Xenorhabdus nemato...
Q7N936        263 EWLFHLVFDHGERdtsLHTVPKWDAg--------------TAQWPVRQDIFSRYEYGFEVRTRRLCQQVLMFHRt 323  Photorhabdus laumo...
CBJ81060      263 EWLFHLVFDYGERtqeINTVPPFKAp--------------SNNWRIRPDRFSRFEYGFEVRTRRLCQQILMFHRL 323  Xenorhabdus bovien...
WP_002210089  262 SWLFSLIFDHGEYsniAEQVPVIIK---------------GKSWNFRQDAFSHFNYGFEVRTRRLCQQVLMYHNL 321  Yersinia pestis
Q87X46        267 LWHFDLIFDYDQRdtrSEPPPEYDE---------------QFTWPVRSDPHSSFAYGFELGNLRLCRQVLMFHHF 326  Pseudomonas syring...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap