6CNM


Conserved Protein Domain Family
SK_channel

?
pfam03530: SK_channel 
Calcium-activated SK potassium channel
Statistics
?
PSSM-Id: 397547
Aligned: 26 rows
Threshold Bit Score: 98.0609
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CNM_A        15 RKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWA-----------------------------LYLFLVKCTI 65 
5_pfamImport   2 RMMLVRSQRQHTSFQLFFGGFGVVLMMVQMEYLWFINTQTLpstcpmesttqcplcfealgtsvpvsegrMVLLALRILI 81 
EKC32236     458 RKQLLRYRTIVVNFEFSFALLGIVLMLIETELFFQGVISKSs----------------------------VASIVLKSCI 509 Pacific oyster
EKC41351      56 RRELLHRRRRIVDTEFTLAMIGIVLMVVETELFISYGMEKVs----------------------------IASIVLKTII 107 Pacific oyster
EKC41352      88 RKQLIERRTKVVDASFVLGIIGIVANVIETELRYGGISSt------------------------------TESVILRIVT 137 Pacific oyster
XP_003118211 258 RSERLTNRVRITDRSLYLALFGVILMLVESEITAERIYGVSka--------------------------hWISQSLRVGV 311 Caenorhabditis ...
NP_001256595  14 RRRLSDLKVKLCDATLILAVGGLILAMLDVEFTATRILESFvn-------------------------tsDLSFILRTAA 68  Caenorhabditis ...
XP_002638621 167 KKTQLKKCGRVCDISLFLAVLGLILVIIDSELTALSDSTGVtk-------------------------asPISVTLRSAC 221 Caenorhabditis ...
6_pfamImport   5 REYLHEKRRMVCDKALAFAIMGIILMIIENELRSSNMIKTEs----------------------------SFSHFLKVCI 56 
POM53415     377 RKQLFIRRNKVCDISLFLAVVGLILVIIDSELTALSGSTGItk-------------------------dsPISIILRSAC 431 Caenorhabditis ...
6CNM_A        66 SISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGR-QAAQIVLELVVCGLHPAPV 122
5_pfamImport  82 TFSTALMLYYIYLYYAAECEVMKLKNIVPPKATLMSSS-LRRTLLIEMAVLGIHPFPG 138
EKC32236     510 TLSTVFLLVAVVGYHVTGIQLCMTDNSLEDWRLAVTFPwTYLKILLELCVCIIHPIPG 567 Pacific oyster
EKC41351     108 SVTTVILLFCICLNYYTGAKIKMVDAGLKEWYMATSYW-HWFGLVLELLICSIHPIPG 164 Pacific oyster
EKC41352     138 SVTSVLLVASVVVYNLIGIKLQLITAGLENWRLVINYS-IIIKVLTEVLICSIHPLPY 194 Pacific oyster
XP_003118211 312 TCSTIVLLYHIILYHLNDIVLELVDCGADDWRVVVTTE-RIIQFCIEFICCAICPLPG 368 Caenorhabditis remanei
NP_001256595  69 IITTIALLFFLLFYHFIDIKIQLVETGTSNWRVGITSE-RVLNTLLEVAICAICPIPE 125 Caenorhabditis elegans
XP_002638621 222 VVSTFFLICCLVNYHAIEVKIALIDSGADDWRVAFSTD-RFVKMLIEVLVCMICPFPG 278 Caenorhabditis briggsae
6_pfamImport  57 IGTTTALLTFVGYFHVIEIQLFMNANAADDWMVALTLR-RFFQIGLELLICMLCPLPI 113
POM53415     432 VVSTFFLICCLVNYHAIEVKIALIDSGADDWRVAFSTD-RFVKMLIEVLVCMICPFPE 488 Caenorhabditis remanei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap