Conserved Protein Domain Family
Microcin

?
pfam03526: Microcin 
Colicin E1 (microcin) immunity protein
Statistics
?
PSSM-Id: 112349
Aligned: 3 rows
Threshold Bit Score: 68.0053
Created: 20-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P22558  31 YYFLASDKMLYAIVISTILCPYSKYAIEHIFFKFIKKDFFRKRKNLNKCPRGKIK 85  Shigella sonnei
P33637  31 YYFLVTDKMLYAIVISTILCPYSKYAIEHIAFNFIKKHFFERRKNLNNAPVAKLN 85  Escherichia coli
Q9I4Y5  27 FPSLASVNPLVVAGLSTILFPFSVKLVEDFALKYTEREFWVTG--FFSETPAKTG 79  Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap