Conserved Protein Domain Family
Macscav_rec

?
pfam03523: Macscav_rec 
Macrophage scavenger receptor
Statistics
?
PSSM-Id: 397543
Aligned: 15 rows
Threshold Bit Score: 80.9478
Threshold Setting Gi: 612029151
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_027391401 120 MESRIQYLSDNEANLLDAKNFQNFSITTDQRFNDVLFQLNSLLSSIQEH 168 hybrid cattle
XP_013840428 113 MEKRIQYLSDNEANLVESEHFQNFTAMTDQRFNDVLSQLNNLLSFIQEH 161 pig
XP_005330849 120 MEKRIQSISDSEANLINSEHFQNFSVTTDQRFNDSLLQLNNLVSSVQEy 168 thirteen-lined ground squirrel
XP_005008656 118 iERRIQDISDAEASFIGSENFQNFSMTTDQRLNSVFLQLNNLVSSVQEH 166 domestic guinea pig
XP_006253268 176 LEERVQSISDSKAGLLDTDRFQNFSMATDQRLNDLLLQLNSLISSVQEH 224 Norway rat
EGV99936      41 MEERIQSISDSKANLIDSERFQNFSMTTDQRLNDVLLQLNSLIAAVQGH 89  Chinese hamster
XP_004757897 184 MENRIQYISDTEANLIDSERFQNFSLVTDQRFNEVLLQLSTLVSSVQRH 232 domestic ferret
Q05585       121 MEKRIQYISDTEENLVDSEHFQNFSVTTDQRFADVLLQLSTLVPTVQGH 169 rabbit
XP_023406931 121 LEKRIHYIADMETNLIDLERFQNFSVTTDQRFNDVLFQLSTLVSSVNGH 169 African savanna elephant
ELV11070     117 MEERIQQISDMQANLIDSECFQNFSVTTDQRFSNVLLQLSTLASSTQGH 165 Chinese tree shrew
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap