Conserved Protein Domain Family
Kv2channel

?
pfam03521: Kv2channel 
Kv2 voltage-gated K+ channel
Statistics
?
PSSM-Id: 397541
Aligned: 6 rows
Threshold Bit Score: 473.232
Threshold Setting Gi: 573892587
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001367942 471 KAGDSANTKDSTDDNHLSPSRWKWARKALSETSSNKSYENKYQEVSQKDSHEQLNN--TSSSPQHLSAHKLEMLYNEITK 548 gray short-tail...
XP_003219622 473 KTEEAANSKETPDDNHLSPSRWKWARGALSEASSNKSLDNKYQEISQRDSQEQLNNaaATSSPQHLSAQKLEMLYNEITK 552 green anole
XP_005663087 251 KTGESANTKDSADDNHLSPSRWKWARKALSETSSNKSYENKYQEVSQKDSHEQLNNt-SSSSPQHLSAQKLEMLYNEITK 329 pig
XP_006634048 475 KRSQ---------DNHLSPSKWTLSKRTLSETSSNKSYETKYQEVVHLGSQERLNN--PNGSPQRLNAQKLEEMYNQMTK 543 spotted gar
XP_005992910 471 KSGEGVNKK----DNHPSPSKWKWSKRTMSETSSNKSFENKYQEVSQQSSHEQLNN--TNASPQHLNAQKLEEMYNEMTK 544 coelacanth
XP_002937117 471 KSADGSNKMEKPSDNHLSPSRWKWSRRTLSETSSNKSFDNKYQEVSQHDSQEQLNN--ASSSPQHLSAQKLEELYNEITK 548 tropical clawed...
XP_001367942 549 tTQPHSHLNASdYQEQAEKPpVYKEEIEMEEVVCPQEQLAVAQTEVIMDMRSTSSIDSFTSCATDFTETERSPLPPYAST 628 gray short-tail...
XP_003219622 553 -TQSQPNLNSP-YQDPSAQP-LYEEEIEMEEVIGQDDPLVSGPRDVVTDMRSTSSIDSFASCATDFTETDRSPLPPYSSS 629 green anole
XP_005663087 330 -TQPHPPPNPN-SQVQPERPsAYEEEIEMEEVVCPQEQLAVAQTEAIVDMKSTSSIDSFTSCATDFTETERSPLPPPSAS 407 pig
XP_006634048 544 -AHSNPSVNTA-GEEQREQApKQETEVEMKVAPSPSDPLL--KERAVTDIRSISSIDSFASCATDFTEAEKSPVPPSITG 619 spotted gar
XP_005992910 545 -TQSQSSISNE-CQDQEIKStVQNEKEDREAVPCPTDPLLTAPANCVTDMKSTSSIDSFASCATDFTETEKSPFPSNINN 622 coelacanth
XP_002937117 549 -AQSHPSVNSS-FQEQAAVPpAYEEEIEMEEVSTKKTQLSVAQKDIVTDMRSVSSIDSFASCATDFTETERSPLTPYPGS 626 tropical clawed...
XP_001367942 629 HLQMRFPPDPTGAEEhQRAKGLPFLTLTREKSSA-PRDATFEYTPIDTTGSPDSVVPPLGLHGPLQFDSATESPKSSLKG 707 gray short-tail...
XP_003219622 630 HLQLRFPMESAHLED-QRARSSQFLSFTRDKMFA-PRDVTFDYSPVDTTMSMDNTGSQFLLHGHMHFDSSMESPKSSLKG 707 green anole
XP_005663087 408 HLQMKFPPDLTGMEEhQRARARPFLTLTREKGPA-AREATSEYAPIDITVNLDTGGSQSGPPGPLQSDSASESPKSSLKG 486 pig
XP_006634048 620 ILQMRHPNVHLPQEEgQ-PSLPEGKTDEKGRERTiIKDGLYEFIPYN-----PDSEILSPKQDHPEFHRVVDSIRSSLRS 693 spotted gar
XP_005992910 623 ELQTEFLANSSPLQDyQTMKNFQPSATLKDSKISiSKDMIYEFNPIQVSMNSTASNSPEPKQGCLYFDSVVESPKSSLKS 702 coelacanth
XP_002937117 627 NLEIRFPSYTVPEEGhD-GNVTQILPRSKYMGFA-PKDVTFEYKLSERSNKNDNGTPKILLQD--QAGNEVESPECSLRR 702 tropical clawed...
XP_001367942 708 SNPLKSRSLKVNFKESRGSAPQTPPSTARPLPVTTmADFTLPTPQHISTILLEE 761 gray short-tailed opossum
XP_003219622 708 SNPLKSRSLKVNFKESRGNAPQTPPSTARPLPVMAaGDFMQSTPQHISTILLEE 761 green anole
XP_005663087 487 SNPLKSRSLKVNFKDSRGGAPQTPPSTARPLPVTT-ADFPMGAPQLISTILLEE 539 pig
XP_006634048 694 NNPAKTKALKVNFIENPGSAPQTPPSTARPLPVTV-SDMMVSSPQHISTILLEE 746 spotted gar
XP_005992910 703 NNPLKSRPLKVNFMENRSSAPQTPPSTARPLPVTM-TDLSLSTPQHISTILMEE 755 coelacanth
XP_002937117 703 NNPLRSRSLKVNFKEGKGMSQAGPTNFTSALPVNM-IDHPLYTHLQLSTIFLRD 755 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap