Conserved Protein Domain Family
Glyco_hydro_52

?
pfam03512: Glyco_hydro_52 
Glycosyl hydrolase family 52
Statistics
?
PSSM-Id: 397535
Aligned: 11 rows
Threshold Bit Score: 618.218
Threshold Setting Gi: 503733711
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAM02957         18 FTLGFRGSRGGLGLEQGKPADEPVFVGCESAEDpNRFLALPFFDP-PTSEAAEAFTSGDE-EEPKmedhffgriaGVTTE 95  Phycisphaera...
WP_015844140     23 FTLGYPGANGGLGLELGKPADQNIYIGCTGREG-SNYELLPFYAG-SDNERQRYVQEEGE-SEAE----------PAALR 89  Paenibacillu...
ADO59156         20 FTLGFKGNRGGLGLELGKPADENVYIGLQSRDG-GSYEALPFFAS-TQDESTRYDVEKKD-KKTE----------PL-LV 85  Paenibacillu...
WP_014369630     21 FTLGFRGKRGGLGLELGKPADENIYIGFESRSG-GYYEALPFFEE-VEDASSRYDVEKAG-EKGK----------ASGLV 87  Paenibacillu...
Q9KB21           22 FTLGFPGSGGGLDLELGRSPKQNVYIGLESEEI-GKYETLPFHLD-AESEAARYDLENPDpNQNK----------PQILF 89  Bacillus hal...
WP_025225516     19 lTIGQKGQTGGLGLELPGPANEGIYVGVEDSEG-GRYRALPFFQS-SEGRAEDFDVEGLA-EFSR----------SPAID 85  Fimbriimonas...
tigr:TERTU_3253   7 FTCGAHGTTGGMGIELSGPYPGEITVGVVDANK-VAH-LLPLFGDsNHSEAERYV------EGKE----------GGGGR 68  Teredinibact...
jgi:Oter_4312    19 FTVGLVDSQGGFGQSLGVPARQNVYVGFRSAQH-ARWQMLPFLN--PPVAAETAFTAEDTvPRP-----------PGGFD 84  Opitutus ter...
WP_013967787     23 liLGRIGKGAGLVIGNVQPPQRGLFIGYRLGAE-TPW-ILPFCPEtKIGLDASAYVDPDApAKPMl--------sPADFS 92  Treponema ca...
WP_011525880     18 FILGEFGKGGGFALSDVHSPHRNVYVAYRVKG--GAVHLLPFLSA-PLGLGELAYQANADrKRRA----------APVVW 84  Deinococcus ...
jgi:Deipe_1735   18 FVLGTIGKGGGFALSDVHSPQRSVYVAYRQGQ--EAVRVLPFLTA-PIGMGELAFQAEADgQARQ----------AVAVQ 84  Deinococcus ...
BAM02957         96 HFPEDAIRRRLGAATDTWQAGD--LTFRVISAGEPVPDPEdpATDEAELKRLTCPAVIAELTLDNTGCDRERKAFFGFGG 173 Phycisphaera...
WP_015844140     90 SFPLDAVTREYKAASDKWRAGD--LSFRILTQIQAVPDPD--QATEEELKAALVPAVWAELTLDNTSGTEARTLFFGYQG 165 Paenibacillu...
ADO59156         86 AFADQDITRELKAGTDTWQAGD--LTFRLYSPVRPVPEPG--IAGIDELRAALVPAVFAELTIDNTEGAAARRAFFGYQG 161 Paenibacillu...
WP_014369630     88 SFGESLITREFKTGTDTWRAGD--LTFRVYSPVRSVPDPG--AADPVRLKEAIVPAVFAELTLDNTQGTTARRGFFGYEG 163 Paenibacillu...
Q9KB21           90 PFGKDEIMRDFNAGTDTWKAGD--LKFTIYSPVQSVPDPS--KASEEELKAAIVPAVLAELTIDNSRGKEQRRAFFGYEG 165 Bacillus hal...
WP_025225516     86 QFRGEEIERTMGAGIDEWRARD--LTFRLISPLRPVPDPD--VCEVDALRDAVTPAILAEITVDNRRGGKARRAFFGYQG 161 Fimbriimonas...
tigr:TERTU_3253  69 VAIEQNITRDYLWCTDRITGGA--TTLQIYSPFFSIPDPA--TATPAQLAFACCPCIHLEVVFNNST-TSTITGIFGLTI 143 Teredinibact...
jgi:Oter_4312    85 ALRPAAYQRTLNWASDTWRADEsrFGFSLLTPFDHVADPA--KMKKSAARFQLAPAIFGWIEYDNRAGTEPVELMFGIGD 162 Opitutus ter...
WP_013967787     93 YFPQETIERSLSLSGEEWKAGL--LSFKVTSFFGSVADPV--SADPSLLRQQLRPALYITLTFDNSKKSEPLIGVFGMQG 168 Treponema ca...
WP_011525880     85 TLPGEELERRLGWASDEWRHGP--FQFRLLSPFGEVPFPG---VDDEALRRAVCPVILAELALDNRESDVPAELLFALEG 159 Deinococcus ...
jgi:Deipe_1735   85 MVSADELERELGWASDEWRHGP--LRLRLLSPFGDVPAPG---SDEAAMKQAVCPVVLAELELDNRNGGAPAELLFALEG 159 Deinococcus ...
BAM02957        174 -NDPYSAMRsf-------------rTPRCRAIAQGRIKAIAvsADQPGTELGQAFDpeaLLRPVR--PGNPEHFIGPMGL 237 Phycisphaera...
WP_015844140    166 -NDPYSNMRrld----------dtmPSGYCGIGQGLRTAIA--TEHAGTYSSLGFDmesILKPRS--KAHHTFGLGSCGA 230 Paenibacillu...
ADO59156        162 -SDPYSGIRiigedprrdatestqlEERLTGIGQGRSTAIV--TNSSEAIPASGFAmekLLGETM--AENLSFGLGTTGA 236 Paenibacillu...
WP_014369630    164 -SDPYSAMRrld----------dtaQGGLTGVGQGRSTAIA--TKDEGVVSALGFSlerILEAKF--PHNYAFGLGGTGA 228 Paenibacillu...
Q9KB21          166 -SDPYSSMRki------------ddTSSVAGVGQGRLTSIV--SNDPSVKSALHFSmedILSNPL--EENWTFGLGKTGA 228 Bacillus hal...
WP_025225516    162 -SDRTVGMRli-------------dEEGLVGVAQHTTTAIA--TDDPGVYAGIAFQaekILQPDC--AENLAFLVGNLGL 223 Fimbriimonas...
tigr:TERTU_3253 144 -DHRWSSLGar-------------tGGNLIGATSRDTIGFA--TQTPGARCFIDFD---AVSAINrrHQSPEFLLGPTAG 204 Teredinibact...
jgi:Oter_4312   163 pSRPLRPLSe--------------aDPKLVGFAGGTGWGYAt-APTRGIELRQGFD---VFAPKFr-DYHGLLVIAAETA 223 Opitutus ter...
WP_013967787    169 vRRPLSDST----------------NGTLLGFAHGTEWGFAc-LPDESIEEVMDWR---AIDAAFn-GNRPIRRLASEGV 227 Treponema ca...
WP_011525880    160 iNRPLSDAT----------------GGALIGAACGRAWGVAa-LPSPGVEEIQDFD---VIGAAFgeRRPRVRRLGNAGG 219 Deinococcus ...
jgi:Deipe_1735  160 iNRPLSDST----------------QGQLLGVASGSAWGVAa-LPGKGVEEVQDFD---VIGATFgeRRPRVRRLGNTGG 219 Deinococcus ...
BAM02957        238 ITTAVPAGETATVRYAVAFFREGRATSGLETAYFYTRFFGDLGGVCDHALATADAAIAGAEALDARVDAAGLSEDRRWQL 317 Phycisphaera...
WP_015844140    231 LLTEVPVGEKVTVRYAICFYQAGIVTSGLSGSYYYTRLFESIESVARYALEQFDAVDAASGQLEVEMEEVGLSEDQKFMI 310 Paenibacillu...
ADO59156        237 LLMDVPAGEKRTYSFAICFYRGGIVTTGIEASYYYTRLFKDIEDVGTYALKHFTDLTAACIQGNDWIESANLSPDQEFML 316 Paenibacillu...
WP_014369630    229 LLMEVPPGEKRTYRFAVCFYRGGLVTSGIDASYYYARYFHSIEEVAGYALDRFADLTASCAAADEWIGAEALSPDQRFML 308 Paenibacillu...
Q9KB21          229 LVVDVKPGEVKTVRFAVCFFRGGVVTAGLDTEYLYTKFFKTIEEVGEYALGQFDAIAAKAAESDELVANSKLSDDQKFMM 308 Bacillus hal...
WP_025225516    224 LVGTVQPGEIRTFRFAIGFFREGTATTGLKTRYLYRRFFDSIEEVLRHALARFDTVCRESEGFDARLRR-RLSPDRAWMA 302 Fimbriimonas...
tigr:TERTU_3253 205 LEIEVPAGETRTLSVALGFFVDGVATYNREMRYYYTRHFTSLTQALSYALEHRQAYLTEADARNRELADSPLSDDRKFMI 284 Teredinibact...
jgi:Oter_4312   224 LVFSVPAGRRKRFPLVLGFYAAGTQTTGLPASYAYTRVFDDLEDVLKHGLEHFDRYAAIAATRDRELDRSRLNPDQRFLL 303 Opitutus ter...
WP_013967787    228 LRIKVNPGETKMVHIALGVYRDGIITSGLRTQTYYSSLFQDLEEVLDSALRDTAFMLATAAELDKGLEQSSLSDDKKFLL 307 Treponema ca...
WP_011525880    220 VMLTVPAGEIGRLVLTLGTYQGGTVTSGLDTSFYYTQFFSGLEEVLAFGLAQAGHFQALATTRDEELLRSGLSEDRQFLL 299 Deinococcus ...
jgi:Deipe_1735  220 VMLTVGAGEVGRLVLALGTYQAGIITTGLDTRFYYTRYFGKLEEAMSFALENAGEYREEARLRDAELAASGLSSERRFLL 299 Deinococcus ...
BAM02957        318 CHAVHSYYGSTQLLddvdprhpasllpgRREGRsPRWVVNEGEFRMMNTFDLTADMIFFALDFHPWTQRNVMDAFIDRYA 397 Phycisphaera...
WP_015844140    311 RHSVHSYYGSTELL--------------DVQGK-PVWIVNEGEYRMINTLDLTVDQLFFEMKMNPWTVRNVLDLFVGRYS 375 Paenibacillu...
ADO59156        317 AQAIHSYYGSTQLLs------------qQEDGE-PIWIVNEGEYRMMNTLDLTADQLYYELILNPWTVRNELEWFVQRYS 383 Paenibacillu...
WP_014369630    309 DHAIHSYYGSTQLL--------------DASGQ-AIWVVNEGEYRMMNTLDLTADQLFYELIMNPWTVRNELELFVNRYS 373 Paenibacillu...
Q9KB21          309 AHAIRSYYGCTQLL--------------EHEGR-PLWVVNEGEYRMMNTFDLTVDHLFFELKMNPWTVKNVLDLFVDRYS 373 Bacillus hal...
WP_025225516    303 AQAIRSYFGSTQLLe-------------REDGR-PLWVVNEGEYRMMNTFDLTVDQAFFELALNPWTVRNVLDLFVERYS 368 Fimbriimonas...
tigr:TERTU_3253 285 AHATRSYYGSTQWLw---------------DGQaSVWVVNEGEYLMMNTFDLTVDMLFHEMRMNPWTVRNVLEQFVCNYS 349 Teredinibact...
jgi:Oter_4312   304 AQSTHSYYGSTQLLw-------------DKRG--PLWMVNEGEYRMINTFDLTVDHVFFELAWHPWAVRDVLDLFVRRYS 368 Opitutus ter...
WP_013967787    308 SHAVHSYCANTELLi-------------SEKGD-PVFIVNEGEYQMMNTLDLTVDQAFFELVYSPWTVKNELDFFLTRSS 373 Treponema ca...
WP_011525880    300 AHATHGYLASTQLLv-------------REDGQ-PLWVVNEGEYRMINTLDLTVDQLFWELRYHPWTTRNVLDLFAERYA 365 Deinococcus ...
jgi:Deipe_1735  300 AHATHGYLASTQLLl-------------REDGS-PLWVVNEGEYRMMNTLDLTVDQLFWELRYHPWTTGNVLDLFVERYS 365 Deinococcus ...
BAM02957        398 YRDEVKFPGETEAdgsprwFPGGLSFTHDHGTTNHFTPAGKSCYEFGDLR-GCFSHMTAEQLTNFVCCAAVY 468 Phycisphaera mikuren...
WP_015844140    376 YKDEVQEYGNPKK------YEGGISFTHDMGVANVFSRPQYSAYEISEIE-DCFSYMTQEQLTNWLLCALVY 440 Paenibacillus sp. JDR-2
ADO59156        384 YRDEVRFPGEEQS------YPGGITFTHDMGVANVFSRQGYSCYELAGID-DCFSYMSHEELVNWLCCATVY 448 Paenibacillus polymy...
WP_014369630    374 YEDKVRFPGDETE------YPGGLTFTHDMGVANVFSRPQYSAYELAGIS-DCFSYMSHEELVNWLCCALVY 438 Paenibacillus mucila...
Q9KB21          374 YEDKVRFPSNDTE------YPGGISFTHDMGVANTFSRKNYSSYELYGLD-GCFSHMTQEQLVNWLLCASVY 438 Bacillus halodurans
WP_025225516    369 YIDEVRFPGSDES------HPGGLAFTHDMGVANAFSRPGYSGYEQSRLN-GCFSYMSAEELMNWVLTAGLY 433 Fimbriimonas ginseng...
tigr:TERTU_3253 350 FQDTVFHASDPNHa-----LPGGISFTHDMGVMNHWSPTGQSAYEVAGLDrQCFSHMTCEQLTNWVLCTGVY 416 Teredinibacter turne...
jgi:Oter_4312   369 YRDR-----------------HGLAFTHDMGVMNHFTMPGRSSYECDHLT-GCFSHMTMEQLLNWVLTAVTY 422 Opitutus terrae PB90-1
WP_013967787    374 YKDA-----------------YGIAFCHDQGVADSFTPVGTSVYELPHLS-ECFSYMSFEETLNWVLTACLY 427 Treponema caldarium
WP_011525880    366 FTDEVKWGEER--------LPGGLSFTHDMGVSNVFTPPGISSYETENLD-GCFSHMTFEQLTNWTLSAILY 428 Deinococcus geotherm...
jgi:Deipe_1735  366 FTDEVKHSGER--------RAGGLSFTHDMGVANVFAPPGQSAYETENLD-GCFSHMTFEELTNWVLSATLY 428 Deinococcus peraridi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap