6VRH


Conserved Protein Domain Family
5HT_transport_N

?
pfam03491: 5HT_transport_N 
Serotonin (5-HT) neurotransmitter transporter, N-terminus
This short domain lies at the very N-terminus of many serotonin and other transporter proteins, eg SNF, pfam00209.
Statistics
?
PSSM-Id: 397524
Aligned: 9 rows
Threshold Bit Score: 64.5311
Threshold Setting Gi: 351710424
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6VRH_A        24 NGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIP 64 
XP_020923180  24 NGVLRKGLPAPGDKAESSHISNGYSAVPSPGAGDDTQNSIP 64  pig
XP_001369431  24 NGILQKGLSATGDKTEMGQISNGYSAVQSPGTEEDTRNSIP 64  gray short-tailed opossum
XP_003770146  24 NGILQKGLTSPGDKAEAGQISNGYSAVQSSGEEGDAQNSnt 64  Tasmanian devil
Q5NCR5        24 NGVLQKGVPTPADKAGPGQISNGYSAVPSTSAGDEAPHSTP 64  house mouse
XP_005327923  24 NGVLQKGVPTTEERPESGQRSNGYSAVPSPSAGDDTPNSMP 64  thirteen-lined ground squirrel
NP_001166489  24 NSILQKSGPTSAGGVESGQIFNGYSSVPSTGMGDDAEHSVP 64  domestic guinea pig
EHB13343     163 NSLLQKSVPASGDKTESGQISNGYSAAPSSSSGGDTGHSVP 203 naked mole-rat
XP_003416833  24 NGALRKGVPAPGDKAEPGQISNGYSSVPSPGAGDDTQHSTP 64  African savanna elephant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap