5W7B,5W7D


Conserved Protein Domain Family
SapB_2

?
pfam03489: SapB_2 
Click on image for an interactive view with Cn3D
Saposin-like type B, region 2
Statistics
?
PSSM-Id: 397523
Aligned: 491 rows
Threshold Bit Score: 27.5036
Threshold Setting Gi: 13182907
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5W7B_A         68 TACYMMVHVFGADIIKLFDKDVNADVVCHTLEFC 101  rabbit
O13035        351 DQCKDFIEVYGQALIDMLLEATNPEAVCVMLKCC 384  chicken
XP_008104840  352 EECRDFVDIYGKSLIDMLLEATDPKVVCESLGCC 385  green anole
XP_021256328  431 GQCKDFVDSYGKAVVIMLLEATDPQAVCTMLHIC 464  helmeted guineafowl
OXU21917     1230 DQCETLVKNYSKQIIEMILADLTPQEVCVYLQLC 1263 Trichomalopsis sarcophagae
EFX82662      584 sDCVRLVDAYSKEIIEMLLADLKPDEVCVALKMC 617  common water flea
OWR46517      679 PACVNFVESHTDQLIEMLIADLTAQEICVFLKMC 712  Danaus plexippus plexippus
XP_011060801  578 DECTDFVKAYSDELIEMILTDLSPQEVCEYLRLC 611  Panamanian leafcutter ant
XP_011153957  582 EQCTDFVKEYSKELVELLLADLTPQEICTYLKLC 615  Jerdon's jumping ant
OXU21917     1025 GQCVDLVKIYSKELIQLLLNDMSPQEVCAYIKLC 1058 Trichomalopsis sarcophagae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap