3G6D


Conserved Protein Domain Family
IL13

?
pfam03487: IL13 
Click on image for an interactive view with Cn3D
Interleukin-13
Statistics
?
PSSM-Id: 397522
Aligned: 15 rows
Threshold Bit Score: 139.114
Threshold Setting Gi: 620983142
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3G6D_A         2 GPVPp-ST---ALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVS- 76  human
Q9XSV9        21 SPVPs-AT---ALKELIEELVNITQNQKVPLCNGSMVWSLNLTSSMYCAALDSLISISNCSVIQRTKRMLNALCPHKPS- 95  cattle
XP_002710138  76 GPVPp-PT---SLKELIEELVNITHNQKAPLCNGTMVWSVNLTGSVYCAALESLVNVSGCNAIQRTQRMLSGLCTDKAV- 150 rabbit
P42203        21 GPVRrsTSppvALRELIEELSNITQDQKTSLCNSSMVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKAS- 99  Norway rat
P20109        21 GPVPrsVSlplTLKELIEELSNITQDQ-TPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAP- 98  house mouse
ELV11436      21 ASVPs-IR---ALKELIEELDNVTQNQKAQLCNGSMVWSVNLTTDVCCVALESLTNVSGCSTLQRTLRLLNGLCTSKSS- 95  Chinese tree shrew
ACH53048      21 GPVPr-LT---KLKELIEELDNITQNQRAPLCNGSMVWSVNLTTDIYCAALESLINVSSCSAIQRTQRILGGLCKQKDL- 95  small-eared galago
XP_004745063  21 GPVHn-LT---TTKELIEELANITQNQ-ASLCNGSMVWSVNRTTSMYCAALESLTSVSNCSAIHRTQRLLKSLCHQDTS- 94  domestic ferret
Q9N0W9        21 SPVTp-SP---TLKELIEELVNITQNQ-ASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPA- 94  dog
XP_021589225  21 GPVPppSP---AFRELIEELVNITQDQKAPLCNGSMVWSVNLTAGEYCAALDSLIKVSNCSAIQKTQRMLSGLCTHKNTa 97  thirteen-lined ...
3G6D_A        77 -AGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFRE 109 human
Q9XSV9        96 -AKQVSSEYVRDTKIEVAQFLKDLLRHSRIVFRN 128 cattle
XP_002710138 151 -AKQVTSVQARDTKIELLQFLKELRRHLQMLYRL 183 rabbit
P42203       100 -D-VASSPP--DTKIEVAQFISKLLNYSKQLFRY 129 Norway rat
P20109        99 -T-TVSSLP--DTKIEVAHFITKLLSYTKQLFRH 128 house mouse
ELV11436      96 -AEQVSSLPTRDTKIEVAQFVKDLLRHLKRLYRH 128 Chinese tree shrew
ACH53048      96 -PG-VPSSHIRDTKIEVAQFIKDLLRHLKKRFRD 127 small-eared galago
XP_004745063  95 -AGQISS---KDTKIEVIQLVKNLLTYARSVFRH 124 domestic ferret
Q9N0W9        95 -AGQISSERSRDTKIEVIQLVKNLLTYVRGVYRH 127 dog
XP_021589225  98 kA---STVPIPDTKIEVGQFVKKLLSHLRCLLRH 128 thirteen-lined ground squirrel
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap