Conserved Protein Domain Family
DMA

?
pfam03474: DMA 
DMRTA motif
This region is found to the C-terminus of the pfam00751. DM-domain proteins with this motif are known as DMRTA proteins. The function of this region is unknown.
Statistics
?
PSSM-Id: 397511
Aligned: 29 rows
Threshold Bit Score: 58.3388
Threshold Setting Gi: 260821318
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001071680 285 RSNLVMLCRVFPQKNPSELETVLRLCNGDVVKAIEK 320 vase tunicate
EEC00304     113 RSPLETLARVFPSRTQASLAAVLDRCQGDVLLAIDE 148 black-legged tick
EFX84867     363 RVPLDTLARLFPQTKRATLKSTLDRCDGDVLRAIEQ 398 common water flea
EFA07078     256 RSPIDVLMRVFPGKRRSDVEALLQRCKGDVVQAMEM 291 red flour beetle
Q178S9       156 RSPVDVLLRVFPNRRRTEVEQLLQRYRGDVVQAMEA 191 yellow fever mosquito
XP_001964762 378 RSPIDVLMRVFPNRRRSDVEQLMQRFRGDVLQAMEC 413 Drosophila ananassae
EEB12158      93 RSPVDILIRAFPNKRRSDIEAVLQRCKGDVLQALEI 128 human body louse
XP_001949339 243 RSAVDVLRRVFPYKRRVDIENVLQRCNGDVLHAIEL 278 pea aphid
XP_002605980 232 tSPREFLVRAFPHVNPSFLELILQGCGGDLDRALEK 267 Florida lancelet
EEC04444     434 gSPLSTLTRVFPSHRPGFLQLVLRSCDGDLIRAIEQ 469 black-legged tick
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap