Conserved Protein Domain Family
Anp1

?
pfam03452: Anp1 
Anp1
The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
Statistics
?
PSSM-Id: 397491
Aligned: 128 rows
Threshold Bit Score: 216.594
Threshold Setting Gi: 149386054
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006685639  86 DFEYYDLNSFTGSA-QG-MKNQDVVLFLMPLrnaEHV-----LSMAFHNIMNLT---YDHSLIDIAFLVSDCSEGDTTLE 155 Yamadazyma tenu...
XP_011276987 153 ktyTFKTNNKENPN-DNiDGEKNDLVILSAVtqqIDSkd-gkFNNFLALLEGLD---YPNSKTSLSILLSSKDEFKKFDE 227 Wickerhamomyces...
EMG50246      96 TSSKYQFEETNGET-NI-DPSKDTILVMSVIgnsAPYgkdreFSHFIQTILTLVe-nQPNYIFSLALLSNNDDEFSRIQG 172 Candida maltosa...
CCE39652     136 qkkeHKL-QPTNKY-TT-INENPSVLILSAIgkdQPYgkdrlFSDFMKTIHTIIe-nQPDLQFNLGLSSNYLTEFENIQK 211 Candida parapsi...
XP_001524121  85 kkiTYTLKQAENEK-VS-SSQKPTVLIVSSVgkdEPYgpgrsFELFMDTILTLIdntDSKYQFSLGLQNNHLAEFNKIES 162 Lodderomyces el...
ABN65744      71 qrsnGNIPVKNSPF-DD-RKTRPTVLIVSTIasnSGYgegrtFVDFFDTISTLYq--HDTHDISLAFLINSASEFSKVET 146 Scheffersomyces...
EDK37041      52 AFNYTKITYVNNDT-PK-TLADDSLLFVATIansESYgpgrqFQDFFSVIKSFD---YDENAISLGFYFGDESEFNTVDK 126 Meyerozyma guil...
EPB83249       3 HHNYMDLNDLNSTR-FG-KEANEHVLVLTPLqndEQY-----LDHYFELLDKTN---YPNHLISIGLLVSDST--DDTLE 70  Mucor circinell...
EPB88649      62 nhlfTNFNHITSSAnHA-QRNKEKILVLTPLkdaSPY-----LDQYFKLLDETS---YPNHLISLAFLVSDSS--DNTLE 130 Mucor circinell...
EIE81055      67 kpsLIDFNQITASA-DA-KRNKEKILVLTPLkdaAGY-----LDRYFELLDRTR---YPNHLISIAFLVSDSS--DGTLE 134 Rhizopus delema...
XP_006685639 156 KTFEYSVALQngtlvdklqreeaikakyrrgssdlyqlymdqdymnnvrksynpryYHKDy-----sKPFRSITIYRKDF 230 Yamadazyma tenu...
XP_011276987 228 YVAKIFKEIE------------------------------------------------NTkdleslkNSFSKITLMNAQF 259 Wickerhamomyces...
EMG50246     173 FFEDETNDLGll------------------------------------------------------sSIFESISIISAPF 198 Candida maltosa...
CCE39652     212 FIDENDAQYF---------------------------------------------------------KYFNTITIVSAPD 234 Candida parapsi...
XP_001524121 163 HIAAKLESLA---------------------------------------------------------TKFHKITLSSAPQ 185 Lodderomyces el...
ABN65744     147 IFNTNSSIYEn--------------------------------------------------------PALRKVTLLSAPF 170 Scheffersomyces...
EDK37041     127 YIHHYFASVK-------------------------------------------------Annq--naPSVNKVTILFAPF 155 Meyerozyma guil...
EPB83249      71 KLYNTVHRLQ----------------------------------------------NRWR-------NRFYEIDVYQKDF 97  Mucor circinell...
EPB88649     131 SLQSHINDIQ----------------------------------------------SRWNy-----rHRFESVRIFKKDF 159 Mucor circinell...
EIE81055     135 LLEYHARRLQ----------------------------------------------RRWS-------NRFESIRIFQKDF 161 Rhizopus delema...
XP_006685639 231 GQA--IGQ----GFSDRHAVKVQGIRRKLMGRARNWLTTNALKPYHSWVYWRDVDIE--TCPGSVIQDLMKHDYDVMVPN 302 Yamadazyma tenu...
XP_011276987 260 IEDef-----kiDRANRQKPEAQKQRRKLLARLRNFLVFNGIGAE-IYSLSVDSDMI--ELPKDLITTFIESGKDIVTIR 331 Wickerhamomyces...
EMG50246     199 LDQnt-----gfSREERHKDSVQRLRRRLIAKSRNFIMLNALESQ-QYILTIDSDMVrfDEAAKIIPTFVNSDKDIIVPR 272 Candida maltosa...
CCE39652     235 LEQtaSGDdeelSRDNRHDDRKQRMRRRLIARCRNYLVSNALTSE-AYTLFIDSDIVefEHASKFIQFLIGSKKDIIVPR 313 Candida parapsi...
XP_001524121 186 LEge------gvSRNDRHNDAMQRTRRRLIARSRNFLISQALADE-QYIITLDSDIIgfEQGPKMLEIMINSNRDIIVPR 258 Lodderomyces el...
ABN65744     171 LEEns-----gfSRDQRHNDNVQRLRRRLIARARNFVLYTALHQE-QYTLFLDADIIklDHSDKVISTFINSKKDIIVPR 244 Scheffersomyces...
EDK37041     156 LEKdyNSI----DRSQRHNDNVQRLRRRNIARTRNFALLHTLAEE-RYTVFMDADVVaiKNP-DMIHQFIASKKDIIVPR 229 Meyerozyma guil...
EPB83249      98 ------------RLDEKPNDTSLNSRRATLARAKNFLLTAALREHHSWVAWVDVKLH--SYPPTIFSDLMLVDGDVVVPN 163 Mucor circinell...
EPB88649     160 D----FDL----PSSRRHEYEMQPLRRSILARSRNWLLSAALKSDTSWVAWIDIDVV--EYPTSIFQDLMRADADVVVPN 229 Mucor circinell...
EIE81055     162 D----FDL----PNEKRHRYEMQPLRRRVMARSRNWLLSASLRHDISWVAWVDVDVV--EYPPTIFEDLIRADVDVIVPN 231 Rhizopus delema...
XP_006685639 303 VWRPLPSfLV-DeppfEQPYDLNSWI--ESDPALELASKLDEDDVIVEGYA-E-YPTWRVHLAYIRD--RN-------GD 368 Yamadazyma tenu...
XP_011276987 332 VDM-----KNsAghvvHKDFDLNSWAgdRKTPTPEQ--DADPNLFFEPGPGpNkIQFSDIHk------nPSkyg-lkrSD 397 Wickerhamomyces...
EMG50246     273 IERPG-----------LRDYDKNSWRgeRTKPNQEQLDKMDNNDWEHWGYVpRdVKANMYHFQTYLDnkDNeyd-lhkDE 340 Candida maltosa...
CCE39652     314 IRRGD-----------LSDYDRNSWRgkRTKPTLEQLQLMDENKWDQFDYVpRdIESEMFHFF-NLDnkDelt--idqQK 379 Candida parapsi...
XP_001524121 259 VTRGG-----------ISDYDRNSWRgkRTKPLQEELDLMDANKWGEFRYVpRdVQGEIYHFYMHVDsqlt----deqKQ 323 Lodderomyces el...
ABN65744     245 IIRDG-----------NQDYDKNSWRgqRTKPDENQLEKMDDDRWEQWDYVpRdVPGKMYHFQNYVDnkNNere-qhlHE 312 Scheffersomyces...
EDK37041     230 VIRGS-----------LIDYDRNSWVgeRTVPNEEQLLKMDQNDWEHWDYVpLdVPGKMIHFQDLIEqqEQtppddvsRR 298 Meyerozyma guil...
EPB83249     164 CLLKRQDdE-------FWGFDRNNWQ--ESDLSLERQQNAAEHEVLMEDYN-Q-YSIGRHLLVDMPT------------H 220 Mucor circinell...
EPB88649     230 CLLKRDDqA-------FWAYDKNNWQ--ETDESKRIQEGLDEDFVLLEGYY-E-FPTYRYLMVDMPT---D-------VD 288 Mucor circinell...
EIE81055     232 CLLSRQDhA-------FWAYDKNNWQ--ETDASRFRQRDLDEEFVLLEGYY-E-FPTYRYLMVDMPT---D-------VS 290 Rhizopus delema...
XP_006685639 369 PNEAVDLDGVGGVSILAKAKLFRQGVHFPAFT 400 Yamadazyma tenuis ATCC 10573
XP_011276987 398 KKSLFELNSVGGAVLFVKTEIFKQGIMFPPYy 429 Wickerhamomyces ciferrii
EMG50246     341 YEYIIPLDSVGGAILFMKSIVVKQGVIFPTSl 372 Candida maltosa Xu316
CCE39652     380 LSYMVELDSVGGAVLFFKSYIFKQGAIFPTSy 411 Candida parapsilosis
XP_001524121 324 LNYAVPLDSVGGAVLFFKSIVFKQGANFPTSy 355 Lodderomyces elongisporus NRRL YB-4239
ABN65744     313 FEYAVPLDSVGGAVLFAKSVIYKQGVVFPTNy 344 Scheffersomyces stipitis CBS 6054
EDK37041     299 PDYIVKLDSVGGAILFAKSMIYKQGVVFPPNy 330 Meyerozyma guilliermondii ATCC 6260
EPB83249     221 QGTRIPLDGVGTTFTLVKATVHREGAVFPPFv 252 Mucor circinelloides f. circinelloides 1006PhL
EPB88649     289 KDYKVELDGVGATFTLVKAHVHREGANFPAFT 320 Mucor circinelloides f. circinelloides 1006PhL
EIE81055     291 PDYKVPLDGVGATFTLVKANVHREGAIFPAFT 322 Rhizopus delemar RA 99-880
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap