4CI8


Conserved Protein Domain Family
HELP

?
pfam03451: HELP 
HELP motif
The founding member of the EMAP protein family is the 75 kDa Echinoderm Microtubule-Associated Protein, so-named for its abundance in sea urchin, sand dollar and starfish eggs. The Hydrophobic EMAP-Like Protein (HELP) motif was identified initially in the human EMAP-Like Protein 2 (EML2) and subsequently in the entire EMAP Protein family. The HELP motif is approximately 60-70 amino acids in length and is conserved amongst metazoans. Although the HELP motif is hydrophobic, there is no evidence that EMAP-Like Proteins are membrane-associated. All members of the EMAP-Like Protein family, identified to-date, are constructed with an amino terminal HELP motif followed by a WD domain. In C. elegans, EMAP-Like Protein-1 (ELP-1) is required for touch sensation indicating that ELP-1 may play a role in mechanosensation. The localization of ELP-1 to microtubules and adhesion sites implies that ELP-1 may transmit forces between the body surface and the touch receptor neurons.
Statistics
?
PSSM-Id: 397490
Aligned: 49 rows
Threshold Bit Score: 81.7995
Threshold Setting Gi: 586739463
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4CI8_A         25 GYVKMFLRGRPVTMYMPkDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYN 98  
XP_002907416  935 GDEFMAVRPWLGAVVAP-T--KAASMKVDSTSPNTRLELERVHGYQAQTASNNARYDSNGKVVYHTAALGIVFD 1005 Phytophthora infest...
EGR30797     1485 GDQFMAVKPWLGAIKEP-T-YKYFKDSKQAEAPPVSIKPQYCYGIRTKDQRGNLRFTKSGKLVYNAAALGIVLD 1556 Ichthyophthirius mu...
XP_001010128 1730 GDEFMAVKPWLGAIKEP-S-YKYFKDKNQFEEPPVTINPYYVFGIRTKDQRGNLRYTSSGKIVYNAAALGIVLD 1801 Tetrahymena thermop...
A0E9H8       1598 GDQFMACKPWMGAIKEP-TYQYYQSKTDGHKPPKCDMEIEYVHGYRTKDMRNNLFFLANGQVLYNAAALGIVLD 1670 Paramecium tetraurelia
A0D307        356 GDEFTIIRPWMGAIKEP-S-NYYKDPLNQNKQPLVELTLEYVHGYRSKDCRNNVKYLKRGQIVYNAAALAVVLD 427  Paramecium tetraurelia
A0CPY1       1615 GDDSVAIRPWMGVVKEP-S-NFFKDPLNQTKQPLIELTLEYVHGYRSKDCRNNVKYVKGNQIIYNTAAVAIVLD 1686 Paramecium tetraurelia
XP_004035187  197 GDEFMAIKPWLGAIKEP-S-NYYKDPLNQSKEPPIQLQIDYVHGYRSKDCRDNIFYLNYGGIVYHAAALGIVLD 268  Ichthyophthirius mu...
XP_001014470 1643 GDEFMAVKPWLGAIKEP-T-TYYKDPLNQSKEPPVSLQLEYVHGYRAKDCRDNIRYLKSGNIVYNAAALGIVMD 1714 Tetrahymena thermop...
XP_002907416 1588 GDEFMAVKPWIGAIVAP-T----NAATPNSREPDLKVELEWVYGYQSELSKQNLVYNTHDEIVYHTAAVGIIYD 1656 Phytophthora infest...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap