3AOH


Conserved Protein Domain Family
GreA_GreB_N

?
pfam03449: GreA_GreB_N 
Click on image for an interactive view with Cn3D
Transcription elongation factor, N-terminal
This domain adopts a long alpha-hairpin structure.
Statistics
?
PSSM-Id: 397488
Aligned: 567 rows
Threshold Bit Score: 39.6618
Threshold Setting Gi: 503322214
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3AOH_Y                5 VKLTKAGYERLMQQLERERE-RLQEATKILQELMESSDDYDDSGLEAAKQEKARIEARIDSLEDILSRAVI 74  Thermus thermophi...
AEB08866              4 VILTQEGYRKLLRELKHLRRiVRPRILEDVMEAAADGRLEKNDQYWEARSRQVQVDRQIHHLQEIIAQSEV 74  Desulfobacca acet...
jgi:Sfum_0226         3 VPITRLGYHRLLRELFFLRHvVRPEVIEELQEARTGGIKIENQQYMLARERHMVLQKKIQDLERKLASCEI 73  Syntrophobacter f...
Q1J0L4                6 IPMTKRGYDKLRETLEYLKTtRREQISEYMGSAIADGDLRESAAYDEARMQQSENEARILELEDQLERAQI 76  Deinococcus geoth...
WP_015236605          6 IQMTRKGYEKLKTDLEYLKTvRREQISEYMGSALADGDLRESAAYDEARMQQSENEARIQEMEDRLSRAVI 76  Deinococcus perar...
Q5SKM1                5 VYLTPEGYRRLQEELNHLKTvKRQEISADFEQALEEGDLRENAGYDEARRAMWQNEARIAQLEDLLSRAVI 75  Thermus thermophi...
WP_013158651          7 VYLTAEGLKRLQDELTTLKTvKRQEIAAAFEQAIEEGDLRENAGYDEARRAQWDNDRRISELESILARAVV 77  Meiothermus silvanus
jgi:Mrub_1100         7 VYLTAEGKARLEQELAYLKTeKMQQIAEEMGRAIAEGDLRENAGYDEARRAMWQNNSRIAELEDILSRVQI 77  Meiothermus ruber...
zhongguo:DGo_PB0233 355 rMISQGTYDSLLARRARLQQ-EADRIADLMGNALEDGDLRESAAYDEARGLMFANQRDLRELEDELSQVQV 424 Deinococcus gobie...
Q3Z8E7                5 IPMTASGYKKLEDELSTLKV-KRIDVIEEMRLAAMDKDMRENAPYHAAKEQRGQIEGRIKEIEHELKYADV 74  Dehalococcoides m...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap