2OUX,2YVX


Conserved Protein Domain Family
MgtE_N

?
pfam03448: MgtE_N 
Click on image for an interactive view with Cn3D
MgtE intracellular N domain
This domain is found at the N-terminus of eubacterial magnesium transporters of the MgtE family pfam01769. This domain is an intracellular domain that has an alpha-helical structure. The crystal structure of the MgtE transporter shows two of 5 magnesium ions are in the interface between the N domain and the CBS domains. In the absence of magnesium there is a large shift between the N and CBS domains.
Statistics
?
PSSM-Id: 397487
Aligned: 117 rows
Threshold Bit Score: 62.5761
Threshold Setting Gi: 123587634
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OUX_A        34 LHIYEQGQFYQSLDEKDRQHLYNYLSPKELADXFDVIEeDNeNXKDYLAEXRPSYAADXLAEXYTDNAVDLLNXLDKSQK 113 Enterococcus fa...
WP_011707783  78 lPAADIADALESLPPDERHVLWQQVDEEKHGQILVEAS-ET-VWDSLISGMSDKELLHALRTLDIDDQIYLGQYLPRNLM 155 Aeromonas hydro...
Q07ZG1        50 AEPGTIALLLESLPLDERYERWQQVDVEERVDVLNLMR-AD-PRLGIVKKMPDEELDLLFSQLSPEDLIEWSDSLPDNIT 127 Shewanella frig...
Q9KLC8        34 ldEGSIALILEAFPVEQRVRLWRSLPLEMHIDVLTEMR-AE-VRISVINALSEIELKLTLAKLDNLSLIEWEDSLPDDII 111 Vibrio cholerae
Q3IF77        36 LSTEHLSLLFEAIPKEQRLEIWQLLDEDTQHEIFVNLS-DD-STLWLLQTLDDSDGFKLLDEVNVEELLELEEVIPERFV 113 Pseudoalteromon...
WP_011771020  34 LSFEQIAVLLEAFPIPLRKLIWQLINQEVQQQVFIEMR-NE-SRQLILNASEDEQCFPLFEKLDADELLDLSENLSDRFV 111 Psychromonas in...
WP_012068777  29 LTPDDVALALESIPLAQRRQAWANIKQANRLDILVEMR-GE-SRQLLLRELDDSEIETLFTDVDAEDLLEITDSLPDRLV 106 Marinomonas sp....
Q21DR3        32 NDPEEIALLLESLPVVQRLSAWEHVRQPARLAILLAMR-HD-ARETIIREASTQELDEIFQGIEAEDLVELAETLPNRMV 109 Saccharophagus ...
Q87I28        39 YQEAQIANILESVNIAYRKRVIEAVPPEKYWTVLNLLR-YD-TAKHIHQSLNKELQHERLAYITDSELIIFADFLPTEFV 116 Vibrio parahaem...
Q4FU66        51 QSEYEIANLLESFPTQSRLLIWAQVPDNIKGEVLAELE-FD-TRQPLMENISSKEISLFTQDLDAQDISEILDTVTESVR 128 Psychrobacter a...
2OUX_A       114 AKYLSLLSSEEAGEIKELLHYEDE 137 Enterococcus faecalis V583
WP_011707783 156 GRLLTSMAPAQRDRVREVIRYGkh 179 Aeromonas hydrophila
Q07ZG1       128 DRALAQMGERQRKHFELYDQYSEN 151 Shewanella frigidimarina NCIMB 400
Q9KLC8       112 SEALSLINRDELELYDQANEFADD 135 Vibrio cholerae
Q3IF77       114 EYAKKQLDEAQTKQYELAQQYPSE 137 Pseudoalteromonas haloplanktis TAC125
WP_011771020 112 DYAVSKMTDKQRALFKKAQEFSND 135 Psychromonas ingrahamii
WP_012068777 107 DIALKQMDNKQREYYQQGIVYDDD 130 Marinomonas sp. MWYL1
Q21DR3       110 DRALAVMDAKQRDLFKDALQYSDD 133 Saccharophagus degradans 2-40
Q87I28       117 DEYLIDQSEESVAHIQQALSYEDN 140 Vibrio parahaemolyticus
Q4FU66       129 TSVMATLDEDIRIQVNKLDTYADW 152 Psychrobacter arcticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap