4U63,3FY4


Conserved Protein Domain Family
FAD_binding_7

?
pfam03441: FAD_binding_7 
Click on image for an interactive view with Cn3D
FAD binding domain of DNA photolyase
Statistics
?
PSSM-Id: 397482
Aligned: 486 rows
Threshold Bit Score: 159.922
Threshold Setting Gi: 497479692
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4U63_A            293 FR-KEIVWREFCYHLLFHFPEL----------------G-----EKNWNDSFDAFSWRDDEKSFKAWTRGMTGYPIVDAG 350 Agrobacter...
Q10W56            283 WLiFELIWRDYFRFICQKHGNKifhks-------glqgI--------------AIPWQEDWEKFRKWQAGQTGFPLVDAN 341 Trichodesm...
jgi:Syn7502_02995 282 WLvFELLWRDYFRFIATKHGNRifkvs-------glqgI--------------NLPWSEDLDKFKLWQMGKTGFPLIDAN 340 Synechococ...
WP_012162902      280 WLiFELIWRDYFRFICAKHGKRvfrvs-------glqgL--------------ALPWQDNRETFEKWQTGQTGFPLIDAN 338 Acaryochlo...
jgi:Sta7437_2986  283 WLiFELIWRDFFHFICAKHGNKifyqs-------glqgI--------------DIPWKEDWKRFNLWQEGKTGYPLVDAN 341 Stanieria ...
jgi:PCC7418_2223  284 WLiFELMWRDYFRFVCLKYGNAvfyqt-------glqgV--------------KIPWKEDWQQFTLWQEGKTGYPLVDAN 342 Halothece ...
WP_006617362      285 WLvFELLWRDYFRFICLKHGPKvfyks-------glqgV--------------KIPWGENWEQWQIWCQGLTGFPLVDAN 343 Arthrospir...
Q2JN91            281 WLvFELLWRDYFRFILAKHGAKlfrps-------giqgI--------------PIPWQQDWPRFQAWCRGETGYPLVDAN 339 Synechococ...
EFC37960          313 WLiFELLWRDYFRFFAEKFGNHifmlkgvtrasskrkgLigdssSNKVESKYDETRWKQDLKLFKLWADGKTGLPFVDAN 392 Naegleria ...
XP_027306164      287 VL-FELLWRDYFRFVALKHGRR----------------I-----FSVRGLQSKEVPWKKDLQlFDCWKEGKTGVPFVDAN 344 mallard
4U63_A            351 MRQLWQHGTMHNRVRMIVASFLIKHLLIDWRKGEKWFRDTLVDADPASNAANWQWVAGSGA-DASPFFRIFNPILQGEKF 429 Agrobacter...
Q10W56            342 MRELLATGFMSNRGRQNVASFLTKNLGINWQMGAEWFESLLIDYDVCSNWGNWNYTAGVGN-DGRG-FRYFNIPKQAKDY 419 Trichodesm...
jgi:Syn7502_02995 341 MQELAATGFMSNRGRQNVASFLTKNMGINWQLGAEWFESMLIDYDVCSNWGNWNYTAGVGN-DARG-FRYFNILKQSQDY 418 Synechococ...
WP_012162902      339 MRELAATGFMSNRGRQNVASFLTKNLGLNWQMGAEWFESCLIDYDVCSNWGNWNYAAGVGN-DARG-FRFFNIVKQAKDY 416 Acaryochlo...
jgi:Sta7437_2986  342 MRELAATGFMSNRGRQNVASFLTKNLGINWQIGAEWFESLLVDYDVCSNWGNWNYTAGVGN-DARG-FRYFNIPKQSKYY 419 Stanieria ...
jgi:PCC7418_2223  343 MREIATTGFMSNRGRQNVASFLTKNLGIDWRMGAEWFESLLIDYDVSSNWGNWNYTAGVGN-DARE-FRYFNIPKQSKMY 420 Halothece ...
WP_006617362      344 MRELAATGFMSNRGRQNVASFLTKNLGINWQMGAEWFESVLIDYDVCSNWGNWNYTAGVGN-DGRG-FRYFNIAKQSQDY 421 Arthrospir...
Q2JN91            340 MRELAATGFMSNRGRQNVASFLTKNLGIDWRMGAEWFESLLIDYDVASNYGNWNYTAGVGN-DARG-FRYFHIPKQSREY 417 Synechococ...
EFC37960          393 MRELKISGWMSNRGRQNVASFLSKDLNLDWRLGAEYFESLLLDHSVTSNWGNWLYAAGVGDvDPRGEARYFNVVKQGFDY 472 Naegleria ...
XP_027306164      345 MRELAATGFMSNRGRQNVASFLTKDLGLDWRMGAEWFEHLLVDYDVCSNYGNWLYSAGVGN-DPRDK-RKFNVIKQGLDY 422 mallard
4U63_A            430 DGDGDYVRRFVPELEKlERKYIHKPF--EAPKDALkkAGVELGKTYPLPIVDHGKARERALAAYAA 493 Agrobacterium fabrum str...
Q10W56            420 DPEGKYVKHWLPELGKvPPAKVHEPWklLPVEQDR--FGVKIGVDYPEPIIDLWQSVKENEKKYNR 483 Trichodesmium erythraeum...
jgi:Syn7502_02995 419 DPEGKYVKHWLPALQSvPTVKVHTPWklLEIEQER--SQIRIGKDYPAPILDLDHSVKVNQKAYNS 482 Synechococcus sp. PCC 7502
WP_012162902      417 DPQGDYVRHWLPELKDvPGGQVQTPWqlTALEQEM--FGLTIGKDYPEPMVDLWQSAKVNEQIYNR 480 Acaryochloris marina
jgi:Sta7437_2986  420 DPKGDYLRHWLPELALiPGSKIHEPWklTSEEQKR--YQIRLGTDYPYPVVDFFKSVKANEKIYNn 483 Stanieria cyanosphaera P...
jgi:PCC7418_2223  421 DPKGNYLRHWLPELRNlPGDLIHEPWklSSDEQKE--YGVTLGVDYPRPVVDFMKSIQANQKlmk- 483 Halothece sp. PCC 7418
WP_006617362      422 DPMGDYVKHWLPELASiPDGRVHSPWrlSNQEQIR--FGVRLGVDYPYPMVDLQESVEANRRIYEK 485 Arthrospira platensis
Q2JN91            418 DPKGDYLRHWLPELAGiPGDKIHEPYrlTAAEQKQ--FGVRLGVDYPRPLVDLEKSLAANRRVYEA 481 Synechococcus sp. JA-2-3...
EFC37960          473 DFNGEFVKLWIPELDQvPQRCIHAPYlmSESEQTN--AKCTIGVDYPKSLVNVKAHHHLNENGvka 536 Naegleria gruberi
XP_027306164      423 DGNGDFVRLWLPELRGiAGADAHAPWalSSAALRQ--AGVILGQTYPQPLVRAPEWSRHINQrlqg 486 mallard
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap