Conserved Protein Domain Family
RP-C

?
pfam03428: RP-C 
Replication protein C N-terminal domain
Replication protein C is involved in the early stages of viral DNA replication.
Statistics
?
PSSM-Id: 397479
Aligned: 46 rows
Threshold Bit Score: 141.585
Threshold Setting Gi: 219952370
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCD31929                  13 PLSLAMVEVQATTRDFaakPdASetvVHKWRLFRALTEAKGPLGVTDRALSVLHALLSFHQETALTlPEGdggdgegdsp 92  Met...
WP_011930733              22 RLTLGMVATERLADDFgtlSeGGq--VDPGRVLAAFKAAAPYLRFGPRVTQAIDWLFRFTQVQDWQ-EGA---------- 88  Aci...
goetting:OCA5_pHCG300030  10 rsspktFSAEKFARTYregKaPA---VTRTAALQVAKRSAAAMGLKAAKLALIDQLFAASKSVDWStPGR---------- 76  Oli...
Q11MP7                    21 RITPAGLAAHRAARDYagdRtLA---VKRIEALQLAKRAAAALGLKAAKIAMIDKLFGYSPAADWTcKDA---------- 87  Che...
WP_012813147              14 KITPAMVAARTTAEALplqA------VEMSDLYRYLRQGRSILGLTCQQTELLCYLIAFTQPADWSgEDDv--------- 78  Ace...
WP_012187065               8 KPTPGLGIAEQLAQAGervA------VPKTRAFVALKRVGAHIGLKAGDMMLLDTLGAFTQAQDWE-EGQ---------- 70  Din...
Q07GS3                     8 KPTPGLVAAEKLAQAGehlS------IPKTRAIVAAKKVAAAIGLKSQDLLLLDTFGAVTQPQDWE-QGK---------- 70  Ros...
Q2K2C8                    12 RVTPGIAASARLAMANdipD------TTKSEMALLLKKAAPVLGIDGTTYHVMDILLGLSQADDWK-GSG---------- 74  Rhi...
jgi:Oant_4539             14 KQTPQRTEFRRLAQTAeigM------VTRGQLIRLAQSLPCLGLINGTEAHLLVVLINTAPAESYD-KGG---------- 76  Och...
WP_012653079              14 RMTKERAEFRRLAQSTevgT------VTRGQLAVLSQSLPCTGLITSTESHLLTVIVNTARADAFD-TGG---------- 76  Agr...
CCD31929                  93 apGIVVFPSNRELSiRAHGMAPATLRRHLASLVEAGLIIRRDSPNGKRFARRGKG-GEIAEAFGFDLAPLIARAAEIENL 171 Met...
WP_011930733              89 --RPIVWPSAAMQM-EALCLSEAQVKRLNRLLAHLGLITMRDSPNGKRYGRRDPR-GRIVEAYGFDLSPIAVRQAEFREI 164 Aci...
goetting:OCA5_pHCG300030  77 --PPIVWPSNARLA-RSLGLSISTMKYHLKGLVEAGLVAYSDHPTYQRRGRRDAE-GNIVEAYGIDLSPIATRFAELHQL 152 Oli...
Q11MP7                    88 --SPIVWPSNEALA-RQLGLSISTARHHLRGLAAAGLIAHASHPTYQRRGVRDDQ-GKIVEAFGIDLSPIIMRYDELLEI 163 Che...
WP_012813147              79 --LPVSTASNLDIQ-QRFDLGRTRVKNLLRELAEAGWLLHRDSPNGQRYRRSNPFtPRSQQAYGFDLSPLARRFDDLKRA 155 Ace...
WP_012187065              71 --RPIVWASNAYLM-EQTGFSLSALKRHARRLAENGVISFQDSPNGKRWGRRDAE-GRIVEAYGFDLSPLSARVEEFEEL 146 Din...
Q07GS3                    71 --RPIVWASNNFLM-EQTGFSLATLKRHARRLCEAGLIAFKDSPNGKRYGRRDED-GVIVEAYGFDLAPLAARTVEFEAL 146 Ros...
Q2K2C8                    75 --RPIVAISNAKLA-EYTLRSQRTVMRCIRRLVEAGVAAYRDSSTGRRFVYRNDK-GEVTAGFGIDFTPSRVRAGELKQA 150 Rhi...
jgi:Oant_4539             77 --RPIVFKSNAALA-FEIGRSEGRVSRVLSRLFDAGVITMQDSGNYKRYPVRDGD-ASIADACGIDLRVLIARFAELDGM 152 Och...
WP_012653079              77 --RPIVFKSNNQLG-FEINRSPGRVSRILSRLFDAGLVTMQDSANFKRYPIRDGE-GELSDACGIDLRVLIARYRELDAL 152 Agr...
CCD31929                 172 AEEVRVENRAIALLREKITLLRRDIAKMIETGM 204 Methylocystis sp. SC2
WP_011930733             165 AERGRARFEALKQLRRRATIAVRGIQQIVETAA 197 Acidiphilium cryptum
goetting:OCA5_pHCG300030 153 AENAEYEAREWRRLSYRRTIMRKEIQSLIVTAG 185 Oligotropha carboxidovorans OM5
Q11MP7                   164 ALAYEQEGRERRTLSYQRTQIRREIEAVLVAAe 196 Chelativorans sp. BNC1
WP_012813147             156 AETALWRQQEGRRLHREVTTLSRTIYALFQTAE 188 Acetobacter pasteurianus
WP_012187065             147 QAELQAERELCQRLKRQITVARRIIRARIEAAV 179 Dinoroseobacter shibae
Q07GS3                   147 HAQLLEERQLCKSLRNTITVMRRVIRAKIEKAL 179 Roseobacter denitrificans OCh 114
Q2K2C8                   151 VIQYHQQLNAELAAKRDISRLSRAIEDLCLSNp 183 Rhizobium etli CFN 42
jgi:Oant_4539            153 VRQAKAEKKALNANLRRYRGAVRNLRYALASMe 185 Ochrobactrum anthropi ATCC 49188
WP_012653079             153 VRQKREEKRANDAAARRFRAALRSARFALmnaa 185 Agrobacterium vitis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap