Conserved Protein Domain Family
CBM_19

?
pfam03427: CBM_19 
Carbohydrate binding domain (family 19)
Statistics
?
PSSM-Id: 112252
View PSSM: pfam03427
Aligned: 2 rows
Threshold Bit Score: 93.6099
Threshold Setting Gi: 116306
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P29026   338 TTTTAAPTATSAPGSCPVANQSCSTQNQYACTADGKYAVCDHGKWVVSSCPSGTVCIPTTD 398 Rhizopus microsporus var. oligosporus
EIE79818 330 ITTTSLATASSALFPLLYAGRSCSSQSKVSCTSTGSYTICNYGKWVTAPCPPGVICLSSAQ 390 Rhizopus delemar RA 99-880
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap