5JBL


Conserved Protein Domain Family
Peptidase_S77

?
pfam03420: Peptidase_S77 
Click on image for an interactive view with Cn3D
Prohead core protein serine protease
Statistics
?
PSSM-Id: 397474
Aligned: 2 rows
Threshold Bit Score: 329.384
Threshold Setting Gi: 34419594
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5JBL_E           25 LLIETWG-------QPGEiidgVPMLE----SHDGKDlglkpgLYIEGIFLQAEVVNRNKRLYPKRILEKAVKDYINEQV 93  Escherichia ...
tigr:KVP40.0361   5 LLIEDWGvssyataETGE----KPLVEakmpAEKGGD------LYIEGIFMQSNVVNRNGRRYPKKVMENAVSKYIQEQV 74  Vibrio phage...
5JBL_E           94 LTKQALGELNAPPRANVDPMQAAIIIEDMWWKGNDVYGRARVIEGDHgpGDKLAANIRAGWIPGVASRGLGSLTDTNEgy 173 Escherichia ...
tigr:KVP40.0361  75 KTNQALGELNHPSRSNVDPAEAAIRITELWWDGDNVMGKAIVLNTPK--GQIVRGLIEGGWVPGVSSRGLGSVKQVDG-- 150 Vibrio phage...
5JBL_E          174 riVNE--GFKLTVGVDAVWGPSAPDAWVTPkeITESQT 209 Escherichia virus T4
tigr:KVP40.0361 151 --INEvqDFRLTVGVDVVWGPSAPAAYVKP--VTESNE 184 Vibrio phage KVP40
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap