3GGZ


Conserved Protein Domain Family
Ist1

?
pfam03398: Ist1 
Click on image for an interactive view with Cn3D
Regulator of Vps4 activity in the MVB pathway
ESCRT-I, -II, and -III are endosomal sorting complexes required for transporting proteins and carry out cargo sorting and vesicle formation in the multivesicular bodies, MVBs, pathway. These complexes are transiently recruited from the cytoplasm to the endosomal membrane where they bind transmembrane proteins previously marked for degradation by mono-ubiquitination. Assembly of ESCRT-III, a complex composed of at least four subunits (Vps2, Vps24, Vps20, Snf7), is intimately linked with MVB vesicle formation, its disassembly being an essential step in the MVB vesicle formation, a reaction that is carried out by Vps4, an AAA-type ATPase. The family Ist1 is a regulator of Vps4 activity; by interacting with Did2 and Vps4, Ist1 appears to regulate the recruitment and oligomerization of Vps4. Together Ist1, Did2, and Vta1 form a network of interconnected regulatory proteins that modulate Vps4 activity, thereby regulating the flow of cargo through the MVB pathway.
Statistics
?
PSSM-Id: 397459
Aligned: 117 rows
Threshold Bit Score: 146.057
Threshold Setting Gi: 297328785
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3GGZ_A         13 KTCLKMCIQRLRYAQEKQQAIAKQSRRQVAQLLLTNKEQKAHYRVETLIHDDIHIELLEILELYCELLLARVQVINDIST 92   baker's yeast
ACN34775       22 KTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATARIRVEHIIREENMMAAQEILELFCELIAVRLPIIEAQKE 101  Zea mays
XP_009394434   18 KTCLNLAISRIKLLRNKRELQLKQMRKEISQYIQTGQEAIARIRVEYIIREQNILAAYEIIELFCEFVLARVPVLESQRD 97   wild Malaysia...
XP_004236982   18 KTCLTLAISRIKLLQNKRDAQLRLMRKEIAQFLQTGQEAIARIRVEHIIREQNVWAAYEILELFCEFVFARVPILESQKE 97   tomato
XP_009401974   21 KTSLKLAVSRMKLLKNKREASVRQMRRDLAQLLESGQEQTARIRVEHVIREEKTMAAYDLIQIYCELIESRLPIIESQKN 100  wild Malaysia...
XP_009102144   15 KTALQMANSRLKILKNKKEIQIKQLRRELAQLLEAGNTPTARIRVEHVVREEKTVAAYELIGIYCELIVVRLGVIESQKN 94   field mustard
XP_020147550   22 KIALKMAMARIKLLRNKKEVQVRQMRREVAQLLDGNQDQTARIRVEHVIREEKFMQAYDLIEVYCELIVARMSIIDSQKT 101  Aegilops taus...
EEF48119       12 KTALKLAVSRIKLLKNKRDAQVKQLKRELAQLLESGQDRTARIRVEHVVREEKTLAAYDLIEIYCELIVARLQIIESQKN 91   castor bean
KRH60150       13 KTALTLAVPRIKLLKNKREANVKQLRRELAQLLHSGHNHAARVRVEHVVKEEKTMAAYDLIKIYCDLIAARMPMIESQRN 92   soybean
ERN15460       12 KTSLKLAIARIKLMKNKKGVQLKQMKRELAQLLQAGQEQNARIRVEHVIREENTRAAYDIIELFCELIVARLPIIESQKH 91   Amborella tri...
3GGZ_A         93 eeqlvkehMDDGINEAIRSLIYAILFVDEVKELSQLKDLMAWKINVEFVNGVIAD-HI-DVPEKIIKKCSPSVPKEELVD 170  baker's yeast
ACN34775      102 --------CPIDLKEAISSVCFAAPRCADLPELMQVQMMFATKYGKEFVAAASELmPDcGVNRQIIELLSIRPPPVDAKL 173  Zea mays
XP_009394434   98 --------CPLELQEAISSIIFASPRCSDLPELLHIRNLFSTKYGKEFVAAASELrPEsNVNRMIIEKLTARAPPAELKI 169  wild Malaysia...
XP_004236982   98 --------CPSELREAVASIIFAAPRCSDLPDLLHVRNLFAAKYGKEFIAAASELrPDtSVNRTIVEKLSVGAPSAELKL 169  tomato
XP_009401974  101 --------CPIDLKEAISSVIFASPRCADIPELMDIRKQFQAKYGKDFVTAAIEVrPEcGVSRMMVEKLSAKAPDVQIKI 172  wild Malaysia...
XP_009102144   95 --------CPIDLKEAVASVLFASQRLSDVPELSEIVKQFTTKYGKDFATSAIELrPDsGVSRLLVDKLSVKAPDGPTKV 166  field mustard
XP_020147550  102 --------CPIDLKEAIASVIFASMRCSDVTELADVRKNFTSKYGKEFATSALEVrPDsGVNRLVIEKLSAGAPDVQTKT 173  Aegilops taus...
EEF48119       92 --------CPIDLKEAISSVLFASPRCADVPELMDVRKHFTAKYGKEFVSAAVELrPDcGVSRLLVEKLSAKAPDGPMKM 163  castor bean
KRH60150       93 --------CPIDLKEAISSVIFASPRCSDIPELVVVKKHIMAKYGREFVSAAVELrPDcGVNRLLVEKLSTSAPDGPTKI 164  soybean
ERN15460       92 --------CPIDLKEAIASLAFASPRCADIPELLDVQKHFAAKYGKDFISSSLELrPGcGVNCTMIEKLSVRAPNGETKI 163  Amborella tri...
3GGZ_A        171 LYLKEIAKTYDVP 183  baker's yeast
ACN34775      174 KLLKEIAEEHEVD 186  Zea mays
XP_009394434  170 KVLKAIAQEYNLV 182  wild Malaysian banana
XP_004236982  170 NVLKEIAKEYNVE 182  tomato
XP_009401974  173 KVLNEVAKEHDVK 185  wild Malaysian banana
XP_009102144  167 KILTEIAEEHNVV 179  field mustard
XP_020147550  174 KTLSSIAAEHNIK 186  Aegilops tauschii subsp. tauschii
EEF48119      164 KILSAIAEEHNVK 176  castor bean
KRH60150      165 RILTAIAEEHNVQ 177  soybean
ERN15460      164 KILTAIAKEHNID 176  Amborella trichopoda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap