6RFL


Conserved Protein Domain Family
Pox_RNA_pol_35

?
pfam03396: Pox_RNA_pol_35 
Poxvirus DNA-directed RNA polymerase, 35 kD subunit
Statistics
?
PSSM-Id: 397458
Aligned: 10 rows
Threshold Bit Score: 439.122
Threshold Setting Gi: 123802090
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6RFL_C   5 REENSIVVELEPSLATFIKQGFNNLVKWPLLNIGIVLSNTSTAVNEEWLTAVEHIPTMKIFYKHIHKILTREMGFLVYLK 84 
Q08FM4   3 REERILAIDLDPNIATFIKHGFNNRVRWPILNIGIILTNKTTAVNEEWLTAIEYLPTRKIFYKHTSRILRRELGFCVYLN 82  Deerpox virus W-848-83
Q9Q8I4   3 RNEKELELKLPPGLATFIKHGFNHKVQWPLLNVGIVLTNKTTAVNEEWLTAVEHMPTRKIFYNYTSGVLRKEVRFCAYLN 82  Myxoma virus
P24757   5 REENSIVVELEPSLATFIKQGFNNLVKWPLLNIGIVLSNTSTAVNEEWLTAVEHIPTMKIFYKHIHKILTREMGFLVYLK 84  Vaccinia virus WR
Q9J540   3 RQEYRIDVSANPSIATFIKHMCKKHLVIPRLNVGVVMINTTTAINEEWLTSIESLPTHKIFYDYVYDIIAMQCNFCIHLK 82  Fowlpox virus strain ...
Q6TVL4   7 vgEAVLAVDLDPAVASLIKHEFAFHLQWPALTQGVVLENTTTCVNEEWLSALEAMPSRHVFHAHVEDVLERRAGLCVFLK 86  Orf virus
Q070A1   5 RSETPLRADVDPNAGSLVKRYINERLLVPTLARAVVMANTTRFTNEEWITAVAFTPLLKTFREHVPRLVAGEINVAVYLS 84  Crocodilepox virus
Q6TUQ1   3 RKERTLDIDLNPGLSTFIKHGFNTYVKWPLLNIGVVLNNTTTAVNEEWLTSIEHMPTRKIFYKYTCDVLKKKISFLVYIN 82  Yaba monkey tumor virus
Q8V3I0   3 REEKTIAIELNPGLATFIKHGFNHRVKWPLLNLGIILNNNTTAVNEEWLTAVEHIPTRKIFYSFTSSILRQEVSFCAYLN 82  Swinepox virus
Q98301   3 REEKTLRIDLPPSVASFIKHGFRHHVRWPTLALGVVLANTTTAINEEWLTAVESMPTRKVFHAFVEPVLEGTLHMCVHLK 82  Molluscum contagiosum...
6RFL_C  85 RSQSERDNYITLYDFDYYIIDKDtNSVTMVDKPTELKETLLHVFQEYR--LKSSQTIELIAFSSGTVINEDIVSKLT-FL 161
Q08FM4  83 KSQTQNKNYISLDDFDYFIIYPD-NKFEKIEKPKELAATLLHTFQEYR--FKNLQTIELIAFSSGTQITEDIINQLT-FL 158 Deerpox virus W-848-83
Q9Q8I4  83 KSQTQDKNYVTLYDFDYYVIHPD-STFTKIDKPKELENTLLHTFQTYK--FKNIQMIELIAFSSGTDITDDVVERLT-FL 158 Myxoma virus
P24757  85 RSQSERDNYITLYDFDYYIIDKDtNSVTMVDKPTELKETLLHVFQEYR--LKSSQTIELIAFSSGTVINEDIVSKLT-FL 161 Vaccinia virus WR
Q9J540  83 KTQKENDSYISLADIDYYIIKPE--EVIKLDPIKELKETLLHSFSEYR--ATNTKTIELAAFSSGTKINDELVNRLS-FL 157 Fowlpox virus strain ...
Q6TVL4  87 FAQSAAGQHVSLHDLDYFIVRGD--ALEAVEKPPQLREMLLHTFHDFR--PKSEQKIELIAFGAGVEVSDKLVDALAaLL 162 Orf virus
Q070A1  85 KTQTADVEYVSLFDFEYLVIDKR-GKVSRVKKAPELKETLIHTFLPFNkgKKTLVRIELVAFDAFAQITPELIKEMS-FL 162 Crocodilepox virus
Q6TUQ1  83 VSQTQEKNYISLYDFDFYVIDLD-FTLKIVDKPKELKNTLLHIFQEYR--VKNLQNIELIAFSSNTQINDKILENMN-FL 158 Yaba monkey tumor virus
Q8V3I0  83 VSQDKDKGYVTLGDFDYYIIESD-YTFNKIDKPKELNETLVHIFQDYR--VKNLQVIELIAFSSGTLIGEEIINQLS-FL 158 Swinepox virus
Q98301  83 KTQSEGDAYVSMHDFDYYVVRDD-GTLSKLKKPKELRETLLHSFLEYR--LKNTKSIELVAFSSGTQIREELLTHLAgVL 159 Molluscum contagiosum...
6RFL_C 162 DVEVFNREYNNVKTIIDPDFVFRSPFIVISPMGKLTFFVEVYSWFDFKSCFKDIIDFLEGALIANIHNHMIKVG---Ncd 238
Q08FM4 159 NVENFNREYENIKPIIDTNFLSIVPFIVTAPLGKLTFYIEHYSWIDFKSHVKEILDYLQGCLIADIHSHKLETSvqeH-- 236 Deerpox virus W-848-83
Q9Q8I4 159 DVETFNREYNNVKSVIGNEFKYHVPFIVTAPLGKLTFYIDHYPWIDLKTHVKDVLDFLEGVLVADVHSHKLDTTirpN-- 236 Myxoma virus
P24757 162 DVEVFNREYNNVKTIIDPDFVFRSPFIVISPMGKLTFFVEVYSWFDFKSCLKDIIDFLEGALIANIHNHMIKVG---Ncd 238 Vaccinia virus WR
Q9J540 158 DTELFNREYKNVKIIHSQNYETYFPFSIIAPEGNISIFMEKYTWFNSSVYFKSMLSYLKEVISDQIAEFNITKLdmeKdt 237 Fowlpox virus strain ...
Q6TVL4 163 DTEAFRREHENVKVVHPREFRGYAPYTAIAPRGRLTLFATTYAWLDDRRQLRDFLAVLERKVLEDVAAHAVAVDvppDpr 242 Orf virus
Q070A1 163 DAEVFNREHANIKSTYEE--RRIYLYKAICCGGRFALFTESYSWFDSRKCLVECLRHVRRKLLDDISSLEIAAVsefDfd 240 Crocodilepox virus
Q6TUQ1 159 NIETFNREYNNIKPILSQKFVGCIPFIVTAPSGKLTFFIDDYEWINLKSHLNDIFNFLEEQLVFDVKSHKLETSvkeN-- 236 Yaba monkey tumor virus
Q8V3I0 159 NIEIFNREYNNIKPILDQKFISCVPFTIIAPLGKLTLFVEHYPWINLKSHLKDIFDFLEGVLISDIHSHKLETSiqdN-- 236 Swinepox virus
Q98301 160 DIEVFTREHANVKVTFPEEPRSTCPFGVIAPRGQLRIFFEAYPWVDTHQHLHAVLRLLERKLVADVRSSQILVTpelDfe 239 Molluscum contagiosum...
6RFL_C 239 ETVSSYNPESGMLFVNDLMTMNIVNFFGCNSRLESYHRFDMTKVDVELFIKALSDAC 295
Q08FM4 237 ASFSSYNSNSGMLFVNDLLTMTVVNFFGCDSRLNSYHKFDMSIIDIETFLKSLSEAF 293 Deerpox virus W-848-83
Q9Q8I4 237 MTTSAYNPSSGMLYVNDLLTMSVVNFFGCNARLHSYHKFDMSTLDTEAFLHALSKAF 293 Myxoma virus
P24757 239 ETVSSYNPESGMLFVNDLMTMNIVNFFGCNSRLESYHRFDMTKVDVELFIKALSDAC 295 Vaccinia virus WR
Q9J540 238 PTSSAYDPKSNIVFVNDITTMCIINFFGCECQLGTYHKFNISSINTKTFHKAVNKTI 294 Fowlpox virus strain NVSL
Q6TVL4 243 EPRSVYCTASGVLYVNDIVTACVARFFGCRARLDSYHRFDMLRADTEELLRTLKAAF 299 Orf virus
Q070A1 241 LNVSQYNEKTGSVLVKDFVILFLLNFCGYDVRLNTYHRVDLKKIDTTKFVKEIEATF 297 Crocodilepox virus
Q6TUQ1 237 QNVSSYNSNSGTLYVNDLLTMCVVNFFGCNSRLNTYHRFDITKVDTYVFLNELSNAF 293 Yaba monkey tumor virus
Q8V3I0 237 VTISSYNSATGILFVNDLLTMSIVNFFGCNARLNSYHRFDISVIDIEDFISALSKAF 293 Swinepox virus
Q98301 240 GGVSKYDPASRMLLVRDMVTMSIVNFFGARAQLDTYHDFDMRVVDTERFLSALAEAF 296 Molluscum contagiosum virus subtype 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap