Conserved Protein Domain Family
ENOD93

?
pfam03386: ENOD93 
Early nodulin 93 ENOD93 protein
Statistics
?
PSSM-Id: 397452
Aligned: 11 rows
Threshold Bit Score: 81.7613
Threshold Setting Gi: 1002276409
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015642550  20 KQSSHEAAIAGLKAAAVTAVCTAIPTFASVRMSKWAKANLgNPVAKTVIITYAAGMAYFIAGEKKVVELSRKHS 93  Japanese rice
CBI20593      30 AECVQEGVREATKAAGVAAVISTVATLGAVRYVPWVKQHI-NYTGRALIISAASVAAFFITADKTILECGKRNT 102 wine grape
NP_001235239  33 KQCTREGVRAGFKAASIAGVASAVPTLAAVRMIPWAKANL-NYTAQALIISAASIASYFITADKTILECARKNa 105 soybean
XP_002525450  50 RRCTQEGVKAGAKAAAVAAVASAIPTLVAVRVIPWAKANL-NYTAQALIISAASISAYFITADKTILECARRNa 122 castor bean
XP_006364894  18 KRCSHEGVIAGAKAAVVASVATAIPTFAIGKMLPWARTYL-NPTAKALIVSTAAGMAYFVVADKTILKTARQNS 90  potato
EMS50052      17 RRCSKEAAMAGSKAAAVAIVAAVVPTLASVRMLPWVKAHL-NPTGQVLVISTVAGMAYFIVADKTILAdktils 89  Triticum urartu
EER89169      17 KRCSREATMAGFKAAAVATVASAVPTLASVRMLPWAKANI-NPTGQALIISTVAGMAYFIAADKKILSLARRHS 89  sorghum
XP_004964508  18 KKSSREAALTGAKAAVAATIVSAIPTLASVRMSPWATANI-NPAGQALIISTVAGMAYFIAADKKILLLARKHS 90  foxtail millet
Q9XGZ3        31 ETSKQAGAIAGAKAAAVAAVASAIPTVAAVRMFPWAKANL-NYTAQALIISSASIAAFFITADKTILQGARRNT 103 thale cress
O82157        16 DAAVHEAVTLGLKNAAISGTVVAVPTLVGCRVLPWAKANL-NYTAQALIISAACIAGFFITADKAILRNARQNT 88  Japanese rice
THU70555      18 QSTVREAAYSGFKTAAISGAIAAVPTLVGCRVIPWAKANL-NYTAQALIISAASVAGFFITADKTILQNARGNS 90  Balbis banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap