Conserved Protein Domain Family
DUF287

?
pfam03384: DUF287 
Drosophila protein of unknown function, DUF287
Statistics
?
PSSM-Id: 146165
View PSSM: pfam03384
Aligned: 13 rows
Threshold Bit Score: 38.569
Threshold Setting Gi: 75099757
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9LZH4  276 ISSIFEPDDEEKYLLRRIVDGNVVDDGISFVDPVVDSWRTCLIKKRKKIWWKDLF 330  thale cress
Q7FZR9  393 ISSVLESDYEEKDLLRRIVDGDHVDDGIGFVDPVVDSWRNRLIKERKRFFWKDMF 447  thale cress
Q9FI24  429 ISSILEPDMDERKMLSRVVEK-HVDDGIGYIDPIVDSWRERLIVEKKKIFWRSLY 482  thale cress
Q9LJ81   14 IDSISEPNSDEKSLLTRIVED-HDDDGLGYIDIIVDSWTDRLLVRKKNIFWNDLY 67   thale cress
Q9SJS4  270 IASHLVPEYHEKYLLDSLLED-DVDDDLDLIDIVIDNWKGRLFVEKKKIWWKGMF 323  thale cress
Q9ZQ65  172 FPSILVPAYHEKYLLKDLLDD-DVDDDCGPIDIVID---KRLLVEKKRIWWKGMC 222  thale cress
O80464  576 IESIIREKAEEVPLLAEITGVE---DDVDKHDVVVDSWMKRL-GQGREIRFEEVY 626  thale cress
Q9LD59  476 IDSIVTLGIEEQKLMKAITEEE---DDVDVADMVVESWEKRR-KEGRLIRFDELY 526  thale cress
Q9FNF5  452 IKSIMLPSPSEKELLKQIMDDEVGHDDVD--DMIVDGWTKRIIKENKPICFEELH 504  thale cress
Q9ZQ04  169 LESILTPTPDEKLRLERIMDVECGVNDVD--DVIADGWKKRLVEEQKAICFELLF 221  thale cress
O80794  143 IQSILASTPDEKLLLERIMDKECEVNDVD--DLIADGWKKRLVDEERTICFEPLL 195  thale cress
Q9S9R6  146 IQSILTPTADEKLLLERTMDVECGVNDVD--DLRL-LWSRL---SEKPVWKKSKV 194  thale cress
Q9LKU1   99 ISSIVEYD--------------VVDEKIGFIDLVVDSWRTRLIKEKKKIWWKDMF 139  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap