Conserved Protein Domain Family
GKAP

?
pfam03359: GKAP 
Guanylate-kinase-associated protein (GKAP) protein
Statistics
?
PSSM-Id: 397439
Aligned: 21 rows
Threshold Bit Score: 275.82
Threshold Setting Gi: 122068834
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1L8T7        684 GRKWRPSIAVQVDSSETLSDSDPEGKALR---EVHSIGVQVEDDKRRARFKR-SNSVTASVQADLETEGFG--------G 751  zebrafish
XP_014325253  752 PKRKLSSIGIQVDCILPV--PREEPLPLTaplKFQSIGVQVENGRP---LSR-DNSMASRQNTEAESQPQD--------A 817  southern plat...
XP_025757413  751 SKRKLSSIGIQVDCLLPV--PREEPLPLAtplKFQSIGVQVENGRP---LSR-DSSMASRQNTETEPQEPKdaapiennT 824  Nile tilapia
XP_004746556  121 PKRKLSSIGIQVDCIQPV--PKEEPSPAT---KFQSIGVQVEDDWR---SSApSHSMSSRRDTDSDTQDA---------N 183  domestic ferret
XP_022531424  742 PRRKLSSIGIQVDCIQEI-QSRVETPPLA---RFQSIGVQVEDGWT---LSR-SSSMASKQETDSDTQDLSltsvttitS 813  Mexican tetra
XP_017212034  118 PRRKLSSIGIQVDCIQEIQAKVETPPPLA---RFQSIGVQVEDGWT---FSR-SSSMASRQETDSDTQDLSltsltfqsG 190  zebrafish
XP_005997933  654 RKSKCLSIGIQVDGPEDS-ANVEEQKPSN---KFQSVGVQVEEERGFRRFAR-SNSVTTAVQADLDSHGNP--------A 720  coelacanth
EGV94190       65 KKNRCLSIGIQVDDAEEP-EKTGENKAPS---KFQSVGVQVEEEKCFRRFTR-SNSVTTAVQADLDFHDNL--------E 131  Chinese hamster
NP_001123829  647 RKN--LSIGIQVDGPEEA-ARAEERQAAF---RYQSVGIQVEEERALRRLTR-SNSVTAAVQADLDLREHF--------E 711  tropical claw...
XP_029686264  819 RKGKCLSIGIQVDGPEEI-PDPED---PS---KFTSVGVQVEDHRGYRRCQR-SNSVTAAVQADLDIPDLL--------G 882  torafugu
Q1L8T7        752 LT---------------VPTQDKGLQFGCSFQRHSSEPESA----------------SQFAEYRTVHTQGQWAYREDYHS 800  zebrafish
XP_014325253  818 TPt-------------eNATNCTNSQTLNSTTTNGQDKAME----------------QHHLKHTSAPSRTSSLPPETLDP 868  southern plat...
XP_025757413  825 TNcansqtvntapngqdKAMEQQPLKHNSAPSRISISPPET------------------------------------LDP 868  Nile tilapia
XP_004746556  184 DSs-------------cKSSERS-LPDCTPHPNSISIDAGP----------------RQA--PKIAQIKRNLSYGDNSDP 231  domestic ferret
XP_022531424  814 NNa-------------cRPTEKKVMVNSASQSVDFSTQLSLdngshdddivvtsgpsRQLLTNRSTTRSSSSSFSESLDP 880  Mexican tetra
XP_017212034  191 s----------------KSAEQKVMVSCGSQAVDSPPPPPPpqdsdpp--vsssgpsRQILTHRSTTQSSSSSFSESLDP 252  zebrafish
XP_005997933  721 SSl-------------eSQEKEN--LCSVSVSRQHSRDAST----------------STVSIQGSGNHYHACAMEDDFST 769  coelacanth
EGV94190      132 NSl-------------eSIEDNS---CPGPMARQFSRDAST----------------STVSIQGSGNHYHACAADDDFDT 179  Chinese hamster
NP_001123829  712 CPv-------------eLADQEF--QFSRPLAKQYSRDACT----------------STVSIQGSGNHYHACAVEEDFDA 760  tropical claw...
XP_029686264  883 TPl-------------dSPDTDMEILPSGVLSRQYSRDAAT----------------STVSIQGSGNHYHACASDDYEDV 933  torafugu
Q1L8T7        801 GYttepgppelralprSHSPLPlapergvGGWS-----EGPRSLPDSG--------RASP-CLRDGEFFLRLLQTEVERM 866  zebrafish
XP_014325253  869 ALd------------pSSLPPP-------DPSLesencSSQGDGV--H--------SSTPaCLRDGNWFLKLLQAETGRM 919  southern plat...
XP_025757413  869 ALd------------pSSLPPP-------DPSLesgncSSQGDAV--Q--------PSTPaCLRDGNWFLKLLQAETGRM 919  Nile tilapia
XP_004746556  232 ALe------------aSSLPPP-------DPWLe----TSSSSPAEPA--------QPGa-CRRDGYWFLKLLQAETERL 279  domestic ferret
XP_022531424  881 ALd------------pSSLPPP-------DPWLesgngTGNGGPT-QT--------TSGTmCRRDGHWFLKLLQAETGRM 932  Mexican tetra
XP_017212034  253 ALd------------pSALPPP-------DPWLesgngTGNGCSNQPL--------SSGTaCRRDGHWFLKLLQAETGRM 305  zebrafish
XP_005997933  770 DFd------------pSILPPP-------DPWIdsv---teDPLE--A--------GQRSvCYRDGHWFLKLLQAERDRM 817  coelacanth
EGV94190      180 DFd------------pSILPPP-------DPWIdsi---teDPLE--A--------VQRSvCHRDGHWFLKLLQAERDRM 227  Chinese hamster
NP_001123829  761 DFd------------pSILPPP-------DPWIdsi---teDPME--A--------VHRSvCHRDGHWFLKLLQAEKDRM 808  tropical claw...
XP_029686264  934 GFd------------pSILPPP-------DPWIdsi---tdDPMDVNVsssailevVQRSvCQRDGRWFLKLLQAESDRM 991  torafugu
Q1L8T7        867 EGWCQNMEREAETNELPEEVLELIRGAVGSAQMLMSQRVQQFFRMCQQSVDPSSYPQPTTQDLASFWDLLQLAIEDVRVK 946  zebrafish
XP_014325253  920 EGWCQQMEQETKDNNLSEEVLGTIRSAVGSAQLLISQKFEQFRGLCNENLNLNANPRPTAQDLAGFWDLLQLSIEDISMK 999  southern plat...
XP_025757413  920 EGWCQQMEQETKDNKLSEEVLGTIRSAVGSAQLLISQKFEQFRGLCNENLNINANPRPTSQDLAGFWDLLQLSIEDISMK 999  Nile tilapia
XP_004746556  280 EGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPEANPRPTAQDLAGFWDLLQLSIEDISMK 359  domestic ferret
XP_022531424  933 EGWCKQMDEETKEHQLSEEVLGKVRSAVGSAQLLMSQKFQQFRGLCDQNLNVNANPRPTAQDLAGFWDLLQLSIEDISLK 1012 Mexican tetra
XP_017212034  306 EGWCCQMEKETTEHQLSEEVLGKVRSAVGSAQLLMNQKFQQFRGLCEQNLNVNANPRPTAQDLAGFWDLLQLSIEDISLK 385  zebrafish
XP_005997933  818 EGWCQQMEREEQENNLPEEILGKIRSAVGSAQLLMSQKFQQFRELCEENLNPNAHPRPISQDLAGFWDMLQLSIENISMK 897  coelacanth
EGV94190      228 EGWCQQMEREERENNLPEDILGKIRTAVGSAQLLMAQKFYQFRELCEENLNPNAHPRPTSQDLAGFWDMLQLSIENISMK 307  Chinese hamster
NP_001123829  809 EGWCQQMKREEHENDLPDPILDKIRSAVGCAQLLMSQKFYQFRELCEENLNPNAHPRPTSQDLAGFWDMLQLSIENISMK 888  tropical claw...
XP_029686264  992 EGWCRQMELDQRENALPEDILGKMRSAVGSAQLLISQKFQQFRELCEENLNPNAHPRPIASDLAGFWDMIQLSIENISLK 1071 torafugu
Q1L8T7        947 FQDLQRLKDSGWRl---PPEKKEDKKVPPPLPKKPiggvtgslradstaesggmlvvSRG---RSLPEREKSLD-VGDRQ 1019 zebrafish
XP_014325253 1000 FDELYQLKANNWQlpekPEKKDENKQLPSSVPKKP----------------------SKP---RLSTGKDRSVDsAVDKQ 1054 southern plat...
XP_025757413 1000 FDELYQLKANNWQl---PEKKDENKQLPSSVPKKQ----------------------SKP---RLSAEKDKSVDsAADKQ 1051 Nile tilapia
XP_004746556  360 FDELYHLKANSWQlvetPEKRKEEKKPPPPVPKKP----------------------AKS---KPAVSRDKASD-AGDKQ 413  domestic ferret
XP_022531424 1013 FDELYHLKSNDWKldrdSPDKQENQKQAPPVPKKP----------------------GKG---KPVLGREKSGE-AADKQ 1066 Mexican tetra
XP_017212034  386 FDELYHLKSNDWKlngeSPEKQENQKQAPPVPKKP----------------------GKS---KPTLGREKSTE-SVDKQ 439  zebrafish
XP_005997933  898 FDELHQLKANNWKqm-dPLDKKE-KRIPPPVPKKP----------------------PKG---QVPLPQERSFE-NNEKQ 949  coelacanth
EGV94190      308 FDELHQLKANNWKqm-dPLDKKE-RRAPPPVPKKP----------------------AKG---PAPLIRERSLE-SS--Q 357  Chinese hamster
NP_001123829  889 FDELHQLKANNWKkm-dSLDKKD-KRAPPPVPKKP----------------------SKG---QAPLVRDRSLE-SSERQ 940  tropical claw...
XP_029686264 1072 FDELHQLRANNWRpv-dPPERKE-RPLPPSVAKKP----------------------PKGphhHPPLVRDRSLE-SSEKQ 1126 torafugu
Q1L8T7       1020 KLETRRRLLQTKRSASFRQNSATESADSIEIYITEAQTRL 1059 zebrafish
XP_014325253 1055 RQEARKRLMAAKKAASVRQNSATESADSIEIYVPEAQTRL 1094 southern platyfish
XP_025757413 1052 RQEARKRLMAAKRAASVRQNSATESADSIEIYVPEAQTRL 1091 Nile tilapia
XP_004746556  414 RQEARKRLLAAKRAASVRQNSATESADSIEIYVPEAQTRL 453  domestic ferret
XP_022531424 1067 RQEARKRLMAAKRAQSVKQNSATESADSIEIYVPEAQTRL 1106 Mexican tetra
XP_017212034  440 RQEARKRLMAAKRAQSVKQNSATESADSIEIYVPEAQTRL 479  zebrafish
XP_005997933  950 RQDARKRLMAAKRAASVRQNSATESADSIEIYIPEAQTRL 989  coelacanth
EGV94190      358 RQEARKRLMAAKRAASVRQNSATESAESIEIYIPEAQTRL 397  Chinese hamster
NP_001123829  941 RHEARKRLMSAKRAASVRQNSATESADSIEIYIPEAQTRL 980  tropical clawed frog
XP_029686264 1127 RQEARKRLMAAKRAASVRQNSATESADSIEIYIPEAQTRL 1166 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap