1LMZ,4AIA


Conserved Protein Domain Family
Adenine_glyco

?
pfam03352: Adenine_glyco 
Methyladenine glycosylase
The DNA-3-methyladenine glycosylase I is constitutively expressed and is specific for the alkylated 3-methyladenine DNA.
Statistics
?
PSSM-Id: 397435
Aligned: 486 rows
Threshold Bit Score: 162.569
Threshold Setting Gi: 183580223
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LMZ_A                   6 WVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAAMQEEDVERLVQDAGI 85 
WP_014402538            17 WAASDPLLQAYHDSEWGRPQHDARALWEKLMLDGFQAGLSWRLILQRRPALRTAFADFDPDILAARHPADIATIMAAPGM 96  Frate...
EFG84492                12 WVGNNALLATYHDEEWGQPVHDGRALWEGLMLEGFQAGLSWVTVLKRREGFRRAFAGFDPVCVAAFDEGDIARLMADPGI 91  Komag...
WP_025421697            13 WARNDALMRDYHDTEWGVPQHDGRMLWEMLMLEGFQAGLSWITVLRKRAAFREAFCGFDPRQVAAFTEQDVQRLLADAGI 92  Sodal...
jgi:M301_0187           18 WAESNALMQAYHDTEWGVPQRDSRMLWEMLMLEGFQAGLSWITVLRKREAFRQAFADFDPVKVANFNEDDINRLMNNEGI 97  Methy...
WP_015829918            12 WAEGDPLMQTYHDTEWAIPIHDSRLLWETLMLEGFQAGLSWITVLRKREAFRQAFANFDPVKVASYGESDILRLMANPGI 91  Methy...
PRJNA213647:NX02_27165  11 WVSEEPLYRAYHDTEWGVPQRDSRMLWEMLMLEGFQAGLAWIIILRKREAFRKAFAGFDPRKVAAFGPDDIDRLMADPGI 90  Sphin...
WP_014785379            14 WANSDPLMKQYHDEEWGVPERDGRMLWETLMLEGFQAGLSWSIILRKRETFREAFLNFDPKKVARFGDREIEILMANPGI 93  Terri...
ELS:G432_06405          11 WAEGDPLMRAYHDGEWGVPERDGRALWEKLMLDGFQAGLAWITVLRKRDAFRRAFAGFDPATVARFGEADVQRLLADPGI 90  Sphin...
BAI94880                 8 WAGSDPLYCAYHDSEWGVPERDSRMLWETLMLEGFQAGLSWITILRKRETFRAAFAGFDPDRVARFDGADVERLMGDPGI 87  Sphin...
1LMZ_A                  86 IRHRGKIQAIIGNARAYLQME-QNGEPFADFVWSFVNHQPQMTQATTLSEIPTSTpaSDALSKALKKRGFKFVGTTICYS 164
WP_014402538            97 IRSPQKIRAVLHNARAWQAMHlAG-EDFAKLAWQVVGGHPVAGDAHA-----TTSavGDELSRRLRRRGFQFVGPRICHA 170 Frate...
EFG84492                92 IRARRKIEATIGNARALLRMH-EQGEDFATFAWSMTPDGPVHNR---TGQVQAQSplSQAMSAALRARGFRFVGPVIVYA 167 Komag...
WP_025421697            93 IRARAKIEATIAGARLYCHMA-DHGESFSDFCWHFTGGEVLKGD---GVTQVASTplSTRISSELKKRGFKFVGPTIVYA 168 Sodal...
jgi:M301_0187           98 IRARAKIQATIAGAKIYCEMK-ARGESFSDFCWSFTERKVLNGN---GSSVPVMTplSEEISKELKRRGFKFVGPTIVYA 173 Methy...
WP_015829918            92 IRARAKIEATIRGAQIYCEME-SRGESFLDFCWSFTDGKVIEGD---GQSWVANSplSERISKELKKKGFKFVGPTIVYA 167 Methy...
PRJNA213647:NX02_27165  91 VRARAKIEATIRGAQIYCEME-DAGERFADYCWSFTDGEPIVSD---GKSWVATSplSERISKDMKRRGFKFVGPTIVYA 166 Sphin...
WP_014785379            94 VRARAKIDSTIKGAQIYLDMK-ERGESFSDFCWSFTDGKVLKGD---GEAFATTTplAEKIAKEMKRRGFKFVGPSITYA 169 Terri...
ELS:G432_06405          91 IRSRAKIEATIGAARLYCDMA-DRGEDFAAYCWSFTEGRVLMGD---GVNFPATTplSERISKDLKRRGFKFVGPTIVYA 166 Sphin...
BAI94880                88 IRARAKIEATIGGARIFRDMR-ERGEDFSAYAWDFVGGEPIRND---GLTFPARTdlSEAISKDLKKRGFKFVGPTIVYA 163 Sphin...
1LMZ_A                 165 FMQACGLVNDHVVGC-CCY 182
WP_014402538           171 WAQACGLIHAHEPECfLfd 189 Frateuria aurantia
EFG84492               168 WMQAMGMIVDHDPGC-IHY 185 Komagataeibacter hansenii ATCC 23769
WP_025421697           169 WMQAVGIVNDHSAEC-FCR 186 Sodalis praecaptivus
jgi:M301_0187          174 WMQAVGIVNDHASDC-FCR 191 Methylotenera versatilis 301
WP_015829918           168 WMQAVGIVNDHAADC-FCR 185 Methylovorus glucosotrophus
PRJNA213647:NX02_27165 167 WMQAVGIVNDHSLTC-FRR 184 Sphingomonas sanxanigenens DSM 19645 = NX02
WP_014785379           170 WMQAVGIVNDHSKTC-FRR 187 Terriglobus roseus
ELS:G432_06405         167 WMQAVGIVNDHAAAC-FRR 184 Sphingomonas sp. MM-1
BAI94880               164 WMQAVGMVNDHAVDC-FRR 181 Sphingobium japonicum UT26S
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap