Conserved Protein Domain Family
GerA

?
pfam03323: GerA 
Bacillus/Clostridium GerA spore germination protein
Statistics
?
PSSM-Id: 397419
Aligned: 415 rows
Threshold Bit Score: 352.064
Threshold Setting Gi: 81367340
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Desgi_3371     119 QTLAKIFRVpqNKDAVFRTLTIgtsppVKAlLVFIDGITNSQVQNMaIL------QPLmlLSGifdrrDSGGQASdnaam 192 Desulfall...
jgi:Cphy_0751       14 NYFNQLFKVdkSFDILCRTFQTg---gRLAcLYFINGFVDDTSLQR-ML------LKLe-TEI-----EEFPK-N----- 71  Lachnoclo...
CCZ52004            15 knidsllcvgdTFDMLKREIRLg---dRHAvFYMIDGFLKGEVLEK-IM------EFFlsLAP-----EDVPE-T----- 73  Clostridi...
wucgs:EUBELI_00753  28 RMMNEKLRVdrNFDILQRDVLIg---gKRThFYFIDGFVQEETIEK-LV------QFFysLKE-----SDI-K-D----- 85  [Eubacter...
CDE35503            22 RSMKKQIRIeeNFDILTREIIIg---gKKAgFFFIDGFVQEDMIEK-LM------QFFysLKP-----EDL-S-D----- 79  Eubacteri...
CDC11638             9 aeldaafrLkaSFDLLGREVKVg---sRRArLYLVDGFCKDDLMEK-IM------AYFmkATD-----DVIQGLA----- 68  Clostridi...
CDB41226            15 aslnLRLRVseSFDLVSRQIMIg---sHRAmLWFIDGFIKDGLMEK-IM------SFMmnADE-----KKLKTVG----- 74  Ruminococ...
CDA81798            30 aELNELLGVgrCFDMTGRDLSIg---gRQArLWVVNGYAQEDLLER-VIagwqalPGLddVTD-----A----------- 89  Firmicute...
BAK98568            13 rhmdTLLGVgrNCDLVARDLIIg---gRKArIWVIDGYGRDAILER-MG------AFWlsLCP-----EQVRTLT----- 72  Oscilliba...
CDB01169            16 dllhrllpLgkSFDLITRDLRLg---eTPAfWLGINGFCNTEILQQ-IF------SDLqdPHY-----TLDSEIR----- 75  Firmicute...
jgi:Desgi_3371     193 sgqggpggqndshpydacckdLFDRvkEALVPNNQVSIAHTFARVVEDVLNGNSALLIDGYNQALLLETKGWHYRNVSTP 272 Desulfall...
jgi:Cphy_0751       72 ----------------------AKEyaEINISYIEIDILKEEKAILKYLFSGISLIFIDGFDEVIAIDARTYPARGVEEP 129 Lachnoclo...
CCZ52004            74 ----------------------YEDflKKCTPYGDIVTVTTEQDFLHYVLSGLTGFVVEGYDEILVIDLRDYPSRSVEEP 131 Clostridi...
wucgs:EUBELI_00753  86 ----------------------IDTflEVGMPYTEIEKNGHYDEVEKAFLSGQTVMIIDGFDECILIDCRTYPMRSVTEP 143 [Eubacter...
CDE35503            80 ----------------------VDSflEKGMPYTEVNKITKQSDALTAFFSGVTVCFIDGFSECLSLDCRTYPMRSVTEP 137 Eubacteri...
CDC11638            69 ---------------------DTRAfaDTYVPYVETDVVAKRVEFITAVLSGAVGMIVEGFTEAIVIDARTYPSRSVDEP 127 Clostridi...
CDB41226            75 ---------------------TTREfaDAFVPYVETEVVNDFDRFETFLFSGALGMIVDGFKEAIIIDVRTYPARSVDEP 133 Ruminococ...
CDA81798            90 -----------------------ADfcRRYVSACDAAAESDRDAAVMGVFAGKTLAIIDGFGGGVVLDAKQFPTRSVEEP 146 Firmicute...
BAK98568            73 ---------------------QMQDfaDRFITFSETNVTCDLVDISTSVLLGKTLLLVEGISGGALMDAKNYPTRSVEEP 131 Oscilliba...
CDB01169            76 ---------------------DLPGyvQSRLGYAQVSLTSSVDDILQNLLSGPSILLVDGFDQAVIIDVRTYPVRSISEP 134 Firmicute...
jgi:Desgi_3371     273 QVEAVIRGPQEAFTEQIRVNTSLVRKIIHRPSLVTEFIKVGNSAPMQCAVMYLDDLANPDLVQEVKRRLESVHGDFMHET 352 Desulfall...
jgi:Cphy_0751      130 EKDKVLRGSRDGFVETIVYNTALIRRRIRSNDLVMKLMEVGESSKTDVVVTYMDGRIDEKLLNRIISKLENLKIDSLSMN 209 Lachnoclo...
CCZ52004           132 DKDKVLRGSRDGFVEAIMPNIALIRRRIRDVDLKFEIYSIGSSSRTDISVVYMKDRVNQKALSIIQKRLKKISVDSLTMN 211 Clostridi...
wucgs:EUBELI_00753 144 YKDKVLRGSRDGFVETLVCNAALLRRRIRDSRFSMEMYTVGERSRTDVAVCYIDDKVDKKLLERIENLISSIEVEALTMN 223 [Eubacter...
CDE35503           138 WKDKVLRGSRDGFVETLVLNAALLRRRIRDPQLSLELMGVGTRSRSDVAVCYMEDKVDKKLLDSIKRRIQAIRVEALTMN 217 Eubacteri...
CDC11638           128 ENDRVLRGAHDGFVETIVFNTALIRRRIRDTALTMEAHSAGEKAKTDIVICYMDGKAKPELLDVVRKKIDGIRINSLSMS 207 Clostridi...
CDB41226           134 ENDKVLRGSHDGFVETLIFNTALIRRRVRDTKLTMYLTQIGKRSKTDIVLCYLDGTADPKEVEKIKKKLNFIDINALTMG 213 Ruminococ...
CDA81798           147 DTSRVLRGSHDGFVENLMQNAALLRRRVRDTHLRLERLQLPERSGTDVALCYMEGEADEGLLRALREKLMHIQLRSVAMS 226 Firmicute...
BAK98568           132 ADGKVLRGAHDGFVEAVVPNMALLRRRIRDPLLTMEGHKVGGRSRTDVVLCYMDDRVDRKLLEQLRRKLDNIDVHSLSMG 211 Oscilliba...
CDB01169           135 DTERSTRGARDGFVETLLFNTNLIRRRVRSAKLTFSICTLGTESRTDVAIAYLADQVNEELLEALKQKLSQLQITSLTMG 214 Firmicute...
jgi:Desgi_3371     353 GL-LEQMIEDSP-WQMVPQVLSTERPDRVAASLLEGQVAILLDGNPFVMVVPCTFFSLMQAPEDAYVRWPLGSFMRVIRY 430 Desulfall...
jgi:Cphy_0751      210 QEsLAESLYRGSwFNPFPKYKYSERPDTTAACILEGSIVILVDNSPASMIIPSSLFDIIEGTDDYYFPPITGTYLRLSRM 289 Lachnoclo...
CCZ52004           212 QEsLAEVLMPRNwWNPYPKFKYTERPDTAAACILEGSITVLVDNSPSAMIIPTSLFDIIEDPNDYYFPPVTGTYLRMTRI 291 Clostridi...
wucgs:EUBELI_00753 224 IEsLAECMFKGKwINPFPKYKYSERPDTAAAALFDGNIVIMVDTSPAVMIIPTNVFDIIEEADDFNFSPMIGTYIRLSRF 303 [Eubacter...
CDE35503           218 IEsLAECLYEHKwINPFPKFKYSERPDTAAAAVLDGNIVIMVDNSPAVMIVPTSIFDIIEEADDYNFAPVIGTYLRISRF 297 Eubacteri...
CDC11638           208 QQsLIECLVPKQrYNPFPKVRYTERPDAAAASVLEGSIVILTDNSPAAMIIPTGIFDFLQDTNDYYMSPFVGSYMRIVRM 287 Clostridi...
CDB41226           214 HEsLAECLIPKQrFNPFPKVRYTERPDSAAASIYEGSLLIITDTSPSVMIIPTGVFDFLQDTNDFYFPSLIGSYLRIVRM 293 Ruminococ...
CDA81798           227 QEtIAEAIAPRQfWNPFPKVRYTERPDVATACIMEGDVVVLVDNSASALLLPTTILRFNEEINDYYFPPLIGTYLQIIRT 306 Firmicute...
BAK98568           212 QEsLAEAIRPKQwYNPFPKIRYTERPDTAAATVLEGHIVVLVDNTPAVMLLPTTVFDYSQEINDFYFPPLVGTYLRILRM 291 Oscilliba...
CDB01169           215 SKsLEELLIHKRwWNPLPSIQLTERPDVACSYLCEGHILLIVDNSPAVLLLPGTIFQFTQSPEDYYNNPLTGTYFRMIRF 294 Firmicute...
jgi:Desgi_3371     431 AGLFLALLLPANYVAIIAYHQEFIPtDL-LLAITGSREKvPFPSIVEVLVMELSFELIREAGIRIPGTVGTTLGIVGALI 509 Desulfall...
jgi:Cphy_0751      290 LISLIALILTPTFLLFMD-NPQWIP-KG-FEFIIVRDPM-NLPLIWQFMILELAIDGLKLAAVNTPSMLSTPLSVVAAVI 365 Lachnoclo...
CCZ52004           292 MTSIMALFVTPVYLLLLR-YPDYVP-DW-LGFVMIQDEM-NVPPLLQLLLLELAIDGLRMAAVNTPSMLTTPLSVVAGIV 367 Clostridi...
wucgs:EUBELI_00753 304 FFTLLTVFLTPVWLLLES-NPQWVP-EW-LKFITISENI-TVPVILQLFILELAVDGLKLAAVNTPGMLSTPLSILAGIV 379 [Eubacter...
CDE35503           298 LLTLVTMLLTPTWLLLID-NPQWLP-EW-MMFITVSDEI-TVPVFFQLLLLELSIDGLKLAAVNTPTLLSTPLSVVAGIV 373 Eubacteri...
CDC11638           288 IIFALTLLLIPVWYLLTK-NPDHIP-QW-LDFIRIEEPN-SVPVLVQLLIVELVIDAMRLASINTPNALSSSFGVIGALV 363 Clostridi...
CDB41226           294 IVFLLALLLTPVWFLLIQ-NPEYIP-PW-LDFIKIEHPT-SVPVIMQLLIIEIVIDALKLASLNTPNALSNSFSVIGALV 369 Ruminococ...
CDA81798           307 LVLLLTMFITPLWYLLVK-NPDTLH-EN-LRFLLVQDEY-YVPLIVQLLLVELIIDILKIASLNTPDVLSNSFSMLGALI 382 Firmicute...
BAK98568           292 TMMILSLFITPMWYLLVN-KPNRMP-DW-LIFLAKPQPC-ALPLLAQLLVVEFLIDLLKLACLNTPNALSNSFSMLGALV 367 Oscilliba...
CDB01169           295 LCIPVSLLLLPVFLLLSAYYPEI---TAsLQLTPVSDLS-PFRLFFYVLAVEFLLDLFKYSAALSSSRVSGALSIVGGLL 370 Firmicute...
jgi:Desgi_3371     510 LGQAAVAANIVSPILIIVVAVTALGSFAIPNYSFSLTIRTLRFIYIILAATFGIFGIMVGFYVHVGAMATLKSF-GVPFL 588 Desulfall...
jgi:Cphy_0751      366 IGDFTVSSGWFNSEAMLYMAFVVLANYTQVSFELGYALKFLRMIMLILTAIFGIWGYGVGIILVIVCVSFNKTVsGRSYL 445 Lachnoclo...
CCZ52004           368 FGDYTVNSGWFNSEIMLYMAFVAVANYTQNNMELGYAIKFQRIILLVLTGVFGIWGFITGILLMIVAFFTNRTMaGRGYL 447 Clostridi...
wucgs:EUBELI_00753 380 VGEYAVESGWFNSESLLYMAVVTVGTYSQASFEMGYALKFIRIVNLILVQFFGRIGLLAGAIFAIVLVCFNRTIsGKSYI 459 [Eubacter...
CDE35503           374 VGEYAVSSGWFNAESMLYMAVVSVGTYSQASFEMGYAMKFMRIILLCLTAAFNLAGYIAGILLIAATIAFNRTMtGCSYI 453 Eubacteri...
CDC11638           364 LGEFAVSAGWFVPEVVLYMAFVALSNFAQPSFELGYAFKILRVVLIILVAFFNLWGLIGGVVLIALLLATTKTVtGQCYL 443 Clostridi...
CDB41226           370 LGEFAIAAKWFTAEVVLYMAFVAITNFAQPSYELGYAFKLCRMMILILTAIFNLWGFIAGLVITALLISFNKTVsGRCYL 449 Ruminococ...
CDA81798           383 LGDFAVQARWLVPEVLVYMAFVAVANYAQHSYEMGYATKLCRMLLLVLIWLWDWWGFAAGIAITLTLIVTAKPLvGKGYL 462 Firmicute...
BAK98568           368 LGNFAVQAKWLTPEVLVYMAAVSIVGFSQPSFEMGYAVKLLRMMLLILSAIFDFWGLLGGTLLIIWLIADNRTVvGPGYL 447 Oscilliba...
CDB01169           371 IGDIAVSLNWASTEVLFYAAVTMLANLSLSSIEFADALRIYRILLVVTTGLWGLPGFLIGLTLVTVSILTTPTFaGFSYF 450 Firmicute...
jgi:Desgi_3371     589 APVAPVtrkG----ADYFLRGPEWRQE 611 Desulfallas gibsoniae DSM 7213
jgi:Cphy_0751      446 YPLIPF---NaknlLRRFFRVTLPNSK 469 Lachnoclostridium phytofermentans ISDg
CCZ52004           448 YPLIPW---DghqlFKRVFRISLTRne 471 Clostridium sp. CAG:75
wucgs:EUBELI_00753 460 YPVIPF---NsqmfKRKILRVRLPHki 483 [Eubacterium] eligens ATCC 27750
CDE35503           454 YPLIPF---DkkmlKRKLLRVRLPHgn 477 Eubacterium sp. CAG:38
CDC11638           444 YPLIPF---NgaalLGLLIRRPISNkn 467 Clostridium sp. CAG:413
CDB41226           450 YPLIPF---NgralTSLLLRKPITKSK 473 Ruminococcus sp. CAG:177
CDA81798           463 YPLIPF---DrkklARLLYRRPVTKKn 486 Firmicutes bacterium CAG:176
BAK98568           448 YPLLPF---NgkalKRLLLREPIGKhn 471 Oscillibacter valericigenes Sjm18-20
CDB01169           451 WPLFPF---NgpalRSLLFRRPTYKAq 474 Firmicutes bacterium CAG:65
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap