Conserved Protein Domain Family
ELF

?
pfam03317: ELF 
ELF protein
This is a family of hypothetical proteins from cereal crops.
Statistics
?
PSSM-Id: 397414
Aligned: 7 rows
Threshold Bit Score: 249.9
Threshold Setting Gi: 1002310614
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
YP_008757372 102 LNHNTPLEDIPGRLKLFLMEEKLSSMRQDVIQEFVALYQRIGPYLPIEPYLVDEALRSYLDHIHATDSFTVLQASYQDLR 181 Aegilops spelto...
AAD00744     102 LNHNTPLEDIPGRLKLFLMEEKLSSMRQDVIQEFVALYQRIGPYLPIEPYLVDEALRSYLDHIHATDSFTVLQASYQDLR 181 Aegilops spelto...
YP_008757372 102 LNHNTPLEDIPGRLKLFLMEEKLSSMRQDVIQEFVALYQRIGPYLPIEPYLVDEALRSYLDHIHATDSFTVLQASYQDLR 181 Aegilops spelto...
XP_015618666 135 LNHNTPLEDIPGRLRLFLMEERTSNVRMDLIQEFLALYARNGAVLPVEPYLLEGALRSYLDSIRATDDFSILQAAYQDLR 214 Japanese rice
YP_008758135 102 LNHNTPLEDIPGRLKLFLMEEKLSSMRQDVIQEFVALYQRIGPYLPIEPYLVDEALRSYLDHIHATDSFTVLQASYQDLR 181 Triticum timoph...
XP_020157802 106 LNHNTPLEDIPGRLKLFLMEEKLSSMRQDVIQEFVALYQRVGPYLPIEPYLVDEALRSYLDHIHATDSFTVLQASYQDLR 185 Aegilops tausch...
AAD00752     106 LNHNTPLEDIPGRLKLFLMEEKLSSMRQDVIQEFVALYQRVGPYLPIEPYLVDEALRSYLDHIHATDSFTVLQASYQDLR 185 rye
YP_008757372 182 ENEGGSVFFRDAVSHNRDLLEAESSARRCLEVEQRIRWEEIPK 224 Aegilops speltoides var. ligustica
AAD00744     182 ENEGGSVFFRDAVSHNRDLLEAESSARRCLEVEQRIRWEEIPK 224 Aegilops speltoides var. speltoides
YP_008757372 182 ENEGGSVFFRDAVSHNRDLLEAESSARRCLEVEQRIRWEEIPK 224 Aegilops speltoides var. ligustica
XP_015618666 215 DHEEGSFFFRDVVSHNRDFLEAQSAKRTWIEVERNSLYSKIER 257 Japanese rice
YP_008758135 182 ENEGGSVFFRDAVsHNRDLLEAESSARRCLEVEQRIRWEEIPK 224 Triticum timopheevii
XP_020157802 186 ENEGGSVFFRNAVSHNRDLLEAESSARRCLEVEQRIRWEEIPK 228 Aegilops tauschii subsp. tauschii
AAD00752     186 ENEGGSVFFENaVSHNRDFLEAESSARRCLEVEQRIRWEEIPK 228 rye
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap